KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1493Help
Entry
HMPREF9154_1493   CDS       T02180                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00010  Glycolysis / Gluconeogenesis
ppc00030  Pentose phosphate pathway
ppc00051  Fructose and mannose metabolism
ppc00052  Galactose metabolism
ppc00680  Methane metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01200  Carbon metabolism
ppc01230  Biosynthesis of amino acids
ppc03018  RNA degradation
Module
ppc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_1493
   00030 Pentose phosphate pathway
    HMPREF9154_1493
   00051 Fructose and mannose metabolism
    HMPREF9154_1493
   00052 Galactose metabolism
    HMPREF9154_1493
  09102 Energy metabolism
   00680 Methane metabolism
    HMPREF9154_1493
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HMPREF9154_1493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppc01009]
    HMPREF9154_1493
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ppc03019]
    HMPREF9154_1493
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9154_1493
Protein phosphatases and associated proteins [BR:ppc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF9154_1493
Messenger RNA biogenesis [BR:ppc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF9154_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat DUF1471
Motif
Other DBs
NCBI-ProteinID: AFN46895
UniProt: I6Y440
LinkDB All DBs
Position
1625706..1627919
Genome map
AA seq 737 aa AA seqDB search
MTVRTRIGVLTSGGDAQGMNAAVRAIVRGAIQAGAEVFAIQEGWQGAVTGGDHIKQMGWN
DVSGILNKGGTVIGTARCLEFRDREGRRTAVRNLVTSGIDRLIVIGGDGSLTGTRQLRLE
WGELLAELVNSGEVGPELAERHPVLQIAGLAGSIDNDMVGTDMTIGTDSALHRITEAIDA
ISATAESHQRTFIIEVMGRNCGYLALMSAIAGGADYTFLPESPPRDGWEDRMVDVLGRGR
RAGRRDSILVVAEGAADRQGEPITANRIRDILKEKSGEDARITILGHVQRGGKPSAYDRW
MATACGVEAVSEVLEASAETEPVLVGVHSDRIGTRPLLASVVATRRIADYIAEGDYEAAI
SSRGPGFQMMIDIYRAITEARPSVADPAGKRIAIMHAGALAPGMNQLARVAVRSGIDLGY
QMLAVRGGMPGLIEGNFDDVSWADVEGMAHTGGADFGTRRYVPSESELYSMARQLEDHRV
DALLVMGGYHAYASVDLMERERRRYPAFNIPVAVVPASIDNNLPGWMMAVGADTALNTVV
DAIDMLRMSASASKRAFIVETMGRGCGFLPLVGGLAGGAEKAYLPETGITLAELETDIKA
LVDAFDSGRNFYLAVVGEGTSEHYTTDVLGKLYEAEGNGRFSVRESVVGHLQQGGTPSPF
DRINATRLAWNAIGYLDRQLRACRSEYAAAHAGAEGLFAPLRDVTDDMDWENMRPHTQWW
RSLRKPFDILSRRPGQK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaggacgagaatcggcgtgctcacctcgggtggggacgcccagggaatgaat
gcagctgtgcgcgcgatcgtgcggggagcgatccaggcgggcgcggaggttttcgccatt
caggagggctggcagggagccgtcacgggtggcgatcacatcaaacagatggggtggaac
gacgtctccgggatcctgaacaagggcggcaccgtcatcgggacggcgcgctgtcttgag
ttccgggaccgcgaggggcgcaggaccgcggttaggaatctcgtgacctccggcatcgac
cggttgatcgtgataggtggcgacggttccctcaccggcacccgccagctgcgcctggaa
tggggtgagttgctggcggagctggtgaacagcggagaagtggggccggaactggccgaa
cgccaccccgtcctccagatcgcggggctcgccggttcgatcgacaacgacatggttggc
accgacatgaccatcgggaccgactccgcgctgcaccgcataacggaggcgatagatgcc
atctccgccaccgcggagtcacaccagagaaccttcatcatcgaggtgatgggacgcaac
tgcggttacctggcgttgatgagcgccatagcgggtggcgcggactacaccttcctgccg
gaatccccgccccgggacggttgggaggaccgcatggtggatgtcctcggccggggcagg
cgggccgggagacgcgactcgattctggtggttgccgagggcgccgcggaccggcagggc
gaaccgatcacggcgaaccgcatccgcgacatcctgaaggagaagagtggggaggacgcc
cggatcacgatcctgggacacgtccagcgcggcgggaaaccctcggcctacgaccgttgg
atggcgaccgcctgcggcgtcgaggcggtttccgaggtactcgaagccagtgccgagacc
gaaccggttctcgtcggcgtgcacagcgaccggatcgggacacgacctctgctggcctcc
gtggtggcgacccgcaggatcgccgattacatagcagagggtgactacgaggccgccatc
tcgtcgcgtggccccgggttccagatgatgatcgacatctaccgggccatcaccgaggcg
cggccgtcggtggcggatcccgcgggcaaaaggatcgcgatcatgcacgccggggcgttg
gccccgggcatgaaccagctggcgagggtcgcggtgcgttccggcatcgacctcggctac
cagatgctggcggtgcgcggtgggatgccgggcctgatcgagggcaacttcgacgatgtc
agctgggctgatgtggagggcatggcgcacaccgggggagcagatttcgggacccgccgc
tacgtcccctcggagtccgagctctactcgatggcgcgtcagctggaggaccaccgggtg
gacgccctcctggtgatggggggataccatgcctacgcgtcggtcgacctgatggaacgg
gaacgtcgacgctatcccgctttcaacatcccggtggcggtggtgccggcgagtattgac
aacaacctcccgggctggatgatggcggtcggggcggacacggccctcaacacggtcgtg
gatgcgatcgacatgctgcggatgagcgcctcggccagcaaacgggcgttcatcgtggag
acgatgggccgcggctgcggtttcctgccgctggtcggtggcttggccgggggagccgag
aaggcatacctaccggagaccggaataaccctcgccgagctcgagaccgacatcaaggcc
ctcgtcgacgccttcgactccgggcggaacttctacctggccgtggtgggggagggaacc
agcgagcactacaccacagatgtgctgggcaagctctacgaggcggaggggaacgggcgg
ttctccgtgcgggagtccgtggttgggcacctgcaacagggcggcaccccctcgccgttc
gaccgcatcaacgccacccggctggcctggaacgccattgggtacctggatcgtcagttg
cgtgcctgccggtccgagtacgctgctgcgcacgccggggccgagggtctgttcgccccg
cttcgtgacgtgaccgatgacatggactgggagaacatgcgcccccacacccagtggtgg
cgttccctgcgtaaaccctttgacatcctgagccgccgccctggccagaaatga

DBGET integrated database retrieval system