KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1878Help
Entry
HMPREF9154_1878   CDS       T02180                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppc  Pseudopropionibacterium propionicum
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF9154_1878 (ahpF)
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF9154_1878 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin DAO Thioredoxin_3 Thi4 K_oxygenase Adeno_PIX FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AFN47279
UniProt: I6X6N2
LinkDB All DBs
Position
2048512..2050098
Genome map
AA seq 528 aa AA seqDB search
MLDANATAQLKKYLELVSLPLELAASLDDSPASAKMRELLSEIAALSPLVSVVEESNPRT
PSFAIRRVGTEIEVRFAGLPMGHEFSSLVLALVQVGGHAPRLDEETAEAVRRLEGGEFVT
YMSLTCQNCPTVVQALNTMSVLNPRIRHVAVEGGAFKDEVEALGIKAVPAIYKDGQLFGQ
GRMDVADFVARLDSGAGARIAEALDAKDPFEVLVVGGGPAGATAAIYSARKALRTGLVAA
RFGGQVLDTMAIENFISVPHTEGPRLGAALEEHVRSHDVDITTGVKASALHPAGEDGLIA
VDIEGGGTLRARSVVLATGAHYRTMGVPGEEEYRNKGVTFCPHCDGPLFKDRPVAVIGGG
NSGIEAAIDLAQVASHVTVVEFLDVLKADAVLVNTLRSLPNVDVLTSTRVVEVVGDGSQV
IGLDVEDRTSGQVRRLDLEGVFVQIGLLPDTGWLDGVIERNRAGEIVVDQRGATSLPGVF
AAGDCANTPYKQIVISLGSGATAALSAFDHLIRSREEADTPATATLRA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacgccaacgccaccgcacagctcaagaagtacctggagctcgtctcgctcccg
ctcgaactcgccgcctcgctcgacgactcccccgcctccgccaagatgcgtgaactcctc
agcgagatcgcggccctcagccccctcgtgagcgtcgtcgaggaatccaacccccgcacc
ccctccttcgcgatccgacgcgtcggcaccgagatcgaggtccggttcgcgggactgccc
atgggacacgagttctcctcactggtgctcgccctggtccaggtcggcggccacgcccct
cgcctggacgaggagaccgccgaggcggtgcgccggctcgaagggggagaattcgtcacc
tacatgtccctgacgtgccagaactgcccgaccgtggttcaggccctcaacaccatgagc
gtcctcaacccgaggatccgtcacgtggcggtcgagggcggcgccttcaaggacgaggtg
gaggcgctcggcatcaaggcggttcccgctatctacaaggacgggcagctgttcggccag
ggtcgcatggatgtcgcggacttcgtcgcccgcctcgattccggggccggcgcgcgcatc
gccgaggcccttgacgcgaaggacccgttcgaggtcctggtcgtcgggggcggccccgcg
ggggcgacggcagccatctactccgcccgcaaggcgctgcgcaccggcctggtcgccgcg
cgattcggcgggcaggtcctcgacaccatggccatcgagaacttcatctcggtgccccac
accgagggtccgcggctcggggccgccctggaggagcacgtccgctcccacgacgtggac
atcaccacgggggtgaaggcctcggcgctgcacccggcgggcgaggacggattgatcgca
gtcgacatcgagggcggcggaacgctgcgtgcccgcagcgtcgtcctggcgacgggcgcc
cactaccggaccatgggcgtccccggcgaagaggagtaccggaacaagggtgtgaccttc
tgcccgcactgcgacggccccctgttcaaggacaggccggttgcggtgatcggtggcggc
aactcgggcatcgaggccgccatcgacctggcgcaggtcgcctcgcacgtgacggtggtg
gagttcctcgatgtcctcaaggccgatgccgtgctggtgaacacgctgcgctccctgccc
aacgtcgacgtcctgacctcgacgcgggtggtggaggtcgtcggtgacggctcccaggtg
atcggcctggatgtcgaggaccgcacctccgggcaggtgcggcgcctggatctggagggg
gtcttcgtccagatcgggctcctgcccgacaccggctggctggacggcgtgatcgaacgc
aaccgtgcgggcgagatcgtcgtcgatcagcgcggcgccacctccctgcccggggtattc
gccgccggtgactgcgccaacaccccctacaagcagatcgtcatctcgctgggttccggg
gccactgcggcactgtccgctttcgaccacctgatccgttcgcgggaggaggcggacacc
cccgccactgctaccctccgggcatga

DBGET integrated database retrieval system