KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2106Help
Entry
HMPREF9154_2106   CDS       T02180                                 

Gene name
mdh_1
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00020  Citrate cycle (TCA cycle)
ppc00270  Cysteine and methionine metabolism
ppc00620  Pyruvate metabolism
ppc00630  Glyoxylate and dicarboxylate metabolism
ppc00680  Methane metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01200  Carbon metabolism
Module
ppc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9154_2106 (mdh_1)
   00620 Pyruvate metabolism
    HMPREF9154_2106 (mdh_1)
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF9154_2106 (mdh_1)
  09102 Energy metabolism
   00680 Methane metabolism
    HMPREF9154_2106 (mdh_1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HMPREF9154_2106 (mdh_1)
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     HMPREF9154_2106 (mdh_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFN45346
UniProt: I6WQF8
LinkDB All DBs
Position
complement(2301311..2302333)
Genome map
AA seq 340 aa AA seqDB search
MDITVERKVRTMSTEAPVKIAVTGAAGQICYSLLFRIASGSLLGDRPIELRLLEITPALK
ALEGVVMELDDCAFPNLKNVVIGDDPKKVFDGVNLAMLVGAMPRKAGMERGDLLSANGAI
FTAQGKALNEVAADDVRVLVTGNPANTNALIASSNAPDIPKERFNALTRLDHNRAKSQLA
QKLGCPVEEIKKMTIWGNHSSTQYPDIFHAEVGGKNAAGLVNDEAWIESTFIPTVAKRGA
AIIEARGLSSAASAANATVEHMRDWVLGTPDGDWVSMAIPSDGSYGVAEGVISSFPCVVK
NGKYEIVQGLEIDPFSRTKIDASVAELLDERKAVKELGLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcaccgtcgaaagaaaggtccgcacgatgagcactgaggctcccgtcaagatc
gcagtgaccggcgcagccggccagatctgctacagcctgctgttccggatagccagcggt
tccctgctgggcgatcggcccatcgagctgcgtctgctggagatcaccccggccctgaag
gccctggagggtgtcgtcatggaactcgacgactgcgccttcccgaacctgaagaacgtc
gtcatcggcgatgacccgaagaaggtcttcgacggcgtcaacctggcgatgctggtcggc
gccatgccccgcaaagccggcatggaacgcggcgacctgctgagcgccaacggcgccatc
ttcaccgcccagggcaaggccctgaacgaggtggccgcggacgacgtccgtgtgctggtg
accggcaaccccgccaacaccaacgcgctgatcgcatccagcaacgcccccgacatcccg
aaggagcgtttcaacgccctcacccgcctggaccacaaccgcgcgaagtcccagctcgcc
cagaaactcggctgccccgtcgaggagatcaagaagatgaccatctggggcaaccactcc
tccacccagtaccccgacatcttccacgccgaggtgggcgggaagaacgccgccggactg
gtgaacgacgaggcctggatcgagtccaccttcatcccgacggtcgccaagcgcggcgca
gccatcatcgaggcccgtggcctgtcgtccgctgcctccgcggcgaacgccaccgtcgag
cacatgcgtgactgggtgctcggcacccccgacggcgactgggtttccatggcgattccc
tccgacggctcctacggggtcgccgagggcgtcatctcctccttcccgtgcgtggtcaag
aacggcaagtacgagatcgttcagggtctcgagatcgacccgttctcccgcaccaagatc
gacgcctccgtcgccgaactgctcgacgagcgcaaggcggtcaaggaactcggcctgatc
tga

DBGET integrated database retrieval system