KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2502Help
Entry
HMPREF9154_2502   CDS       T02180                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00250  Alanine, aspartate and glutamate metabolism
ppc00410  beta-Alanine metabolism
ppc00430  Taurine and hypotaurine metabolism
ppc00650  Butanoate metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF9154_2502
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF9154_2502
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF9154_2502
   00430 Taurine and hypotaurine metabolism
    HMPREF9154_2502
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9154_2502
Enzymes [BR:ppc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HMPREF9154_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFN45150
UniProt: I6XZH2
LinkDB All DBs
Position
2702289..2703764
Genome map
AA seq 491 aa AA seqDB search
MRQDRFIPGACEGQAPSPERIEVAMSPSHPHRTASAGTRQVELNPLFARPGEATELPRTR
LPRGESLPETAYQIVHDEAMLDGNARLNLATFVGTWMDDHANRLALESADKNMIDKDEYP
RTAEIETRCWQMLADLWHSPDPEHTIGTSTIGSSEAAMLGGLALKRRWQQARRAAGKSAD
RPNLVMSSAVQVCWEKFCNYWDVEARYVPVSREHPIFDGHDLEHYVDENTIGVVAIMGIT
YTGRYEPVAGIAAALDRIQAETGLDVRIHVDGASGAMVAPFLQPDLEWDFRLERVVSINT
SGHKYGLVYPGLGWVVWRTADDLPEDLVFRVSYLGGDMPTFALNFSRPGSQVLLQYYLFL
RLGFDGYRRVHETSRSVATFLSGEIGAMDDFELCSDGTDIPVFAWRLTQRPGRNWGLHDL
SDRLRMKGWLVPTYPLPNDLADELVQRVVVRNGFSHDLAHAFLDDLRCEVDHLNTLTAPM
PAITRQSGFHH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaggatcggttcatccccggagcatgcgagggtcaggcaccctcgccggaacga
atcgaggtggccatgagcccgtcacacccccaccgcaccgcatccgccggcacgcgccag
gtggagttgaatcccctcttcgcccggccaggtgaggccaccgagctgccgcgcacccgc
ctgccccgaggcgaatcgctgccggaaaccgcctaccagatcgtccacgacgaggcgatg
ctcgacggcaacgcccgcctcaacctggccaccttcgtcggcacctggatggacgatcac
gccaaccgcctggcgttggagtcggcggacaagaacatgatcgacaaggacgagtacccc
cgcaccgcggagatcgaaacccgctgctggcagatgctcgccgacctgtggcactccccc
gacccggaacacacgatcggcacctcgacgatcggatcgtcggaggcggcgatgctgggc
ggcctggcgttgaagcgtcgctggcagcaggcccgccgcgccgccgggaaatccgcggac
cgccccaacctggtgatgtccagcgccgtgcaggtgtgctgggagaagttctgcaactac
tgggacgtggaggcgcgctacgtgccggtcagccgggaacatccgatattcgacggccac
gacctggaacactacgtcgacgagaacaccatcggtgtggtcgcgatcatgggaatcacc
tacacgggacgctacgaaccggtcgccgggatcgcggccgccctggaccgcatccaggcc
gaaaccggactcgacgtcaggatccacgtcgacggtgcgtcgggggcaatggtggcgccc
ttcctgcaaccggacctggaatgggacttccggctggaacgggtggtctccatcaacacc
tcgggacacaagtacgggctcgtgtacccgggtctggggtgggtggtgtggcgcaccgcc
gacgacctgcccgaggatctggtgttccgggtcagctacctgggaggcgacatgccgacc
ttcgcgctgaacttctcccgccccggatcgcaggtgctgctgcagtactacttgttcctg
cggctcggtttcgacgggtaccggcgcgtccacgagacgtcgcggtcggtcgccactttc
ctgtcgggcgagatcggcgccatggacgacttcgaactgtgcagcgacggcaccgacatt
cccgtcttcgcctggcgcctcacgcaacgccccggccgcaactggggcctgcacgacctc
tccgaccggctgcgaatgaagggctggctggtgcccacctaccccctgcccaatgacctg
gccgacgaactggtgcagcgcgtcgtggtccgcaacggtttcagccacgacctggcccac
gccttcctcgacgacctgcgctgcgaggtcgaccacctgaacaccctgacagcccccatg
ccggcgatcaccaggcagtccggtttccaccactga

DBGET integrated database retrieval system