KEGG   Pelobacter propionicus: Ppro_0665Help
Entry
Ppro_0665         CDS       T00436                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppd  Pelobacter propionicus
Brite
Translation factors [BR:ppd03012]
 Eukaryotic Type
  Elongation factors
   Ppro_0665
 Prokaryotic Type
   Ppro_0665
Mitochondrial biogenesis [BR:ppd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Ppro_0665
Exosome [BR:ppd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ppro_0665
  Exosomal proteins of breast cancer cells
   Ppro_0665
  Exosomal proteins of colorectal cancer cells
   Ppro_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ABK98296
UniProt: A1ALS6
LinkDB All DBs
Position
704085..705275
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAGKGQAEFKAFDQIDNAPEERERG
ITIATAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVYLNKADMVDDEELLELVELEIRELLSSYDFPGDDIPIVKGSALKALE
GEKSELGEDSIIKLMDAVDSYIPDPERAVDKPFLMPVEDVFSISGRGTVATGRVERGIVK
VGEEVEIVGIKATAKTTVTGVEMFRKLLDEGRAGDNIGALLRGIKREEIERGQVLAKPGS
ITPHTKFKAEAYILNKEEGGRHTPFFNGYRPQFYFRTTDVTGIVDLPAGTEMVMPGDNVA
VTVNLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggctaaatttgagcgcaccaaaccgcatgtaaacattggcacgattggtcac
gtcgaccacggcaagaccacgttgactgccgccatcacaaaggtgctggcaggcaagggt
caggcagagttcaaggctttcgaccagattgacaacgcacctgaagagcgtgagcgcggt
ataaccattgccaccgcacacgtggaatacgagactgacaagcgtcactatgcccacgtt
gactgtccgggtcatgccgactacgtcaagaatatgatcaccggcgccgctcagatggac
ggagccattctggttgtttccgcagctgacggccctatgccccagacccgcgagcacatc
ctgctcgcccgtcaggttggcgtaccctatattgtcgtgtacctgaacaaggccgacatg
gtcgatgacgaggagcttcttgagttggtcgagctcgaaatccgcgagctactctcctcc
tatgactttcccggtgacgatattcctatcgttaaaggttccgccctcaaggcgctagaa
ggcgaaaagagtgagttgggcgaggattccatcatcaagctgatggacgctgttgatagc
tacatccccgatccggagcgtgcggtggacaagcccttcctgatgccggtagaggatgtg
ttctccatctcaggtcgtggtaccgttgccaccggtcgtgttgagcgcggcatagtcaag
gttggtgaggaggtcgagatcgttggcatcaaggccaccgccaagacaaccgtcaccggt
gtggagatgttccgcaagcttctcgacgagggtcgtgccggagacaatatcggcgcactg
ctgcgcggtatcaagcgcgaggaaatcgagcgcggtcaagttcttgccaagcctggttca
atcactccgcacaccaagttcaaggctgaggcctatatcctcaacaaggaagagggtgga
cgtcacaccccattcttcaacggataccgtccccagttctatttccggacaacggacgtt
accggtattgtcgacctgccggcaggcactgaaatggtcatgcctggcgacaacgtggct
gtaaccgtcaacctgatcactccgatcgccatggatgaaggtctgcgcttcgccatccgt
gaaggcggccgcactgttggcgccggcgtcgtcagctcgatcatcgaatag

DBGET integrated database retrieval system