KEGG   Pelobacter propionicus: Ppro_1161Help
Entry
Ppro_1161         CDS       T00436                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00061  Fatty acid biosynthesis
ppd00620  Pyruvate metabolism
ppd00640  Propanoate metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
ppd01212  Fatty acid metabolism
Module
ppd_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ppro_1161
   00640 Propanoate metabolism
    Ppro_1161
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Ppro_1161
Enzymes [BR:ppd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Ppro_1161
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Ppro_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC TF_Zn_Ribbon Tmemb_55A Prok-RING_1 zf-IS66 UPF0547
Motif
Other DBs
NCBI-ProteinID: ABK98784
UniProt: A1AN64
LinkDB All DBs
Position
complement(1211656..1212510)
Genome map
AA seq 284 aa AA seqDB search
MSWFHRERAGINRTQIKKSRVPQGMWVKCPGCSATLLAKDLDANLNVCPTCGHHHRIGAR
RRLESLLDAATWQELDSGMTSVDFLQFKDSKSYQERIDSALSKGGSRDAVVCVEGSIEGT
AVQVAVFDFSFMGGSMGSVVGEKITRAIERGVQKRQPVIIVSASGGARMQESILSLMQMA
KTSAALAKLKDAGLPFISILTDPTTGGVTASFAMLGDINIAEPKALIGFAGPRVIEQTLR
QKLPDGFQRAEYLLEHGMLDVIVPRTEMRAKLASILGILYRPAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagctggttccacagggaaagagcaggcatcaacaggacacagatcaaaaaaagcagg
gtaccccaggggatgtgggtcaaatgccccggttgttccgccaccctgctcgccaaagat
ctggatgccaatctgaatgtctgtcccacgtgcggacaccaccaccgcatcggcgcacgt
cgccgcctggagtccctgctggacgcagcgacctggcaggagctggacagcggtatgaca
tcggtggacttcctccagttcaaggactctaagagttaccaggagcgcatcgacagcgcc
ctctccaaggggggctctcgggatgccgtggtctgcgtggagggaagcatcgaggggacc
gccgtacaggttgccgtgttcgacttctcattcatggggggcagcatggggagcgtggtg
ggtgaaaagatcacccgcgccatcgaacgaggcgtgcagaagcgccagccggtgatcatc
gtctccgcctcgggcggcgcccgcatgcaggagagcatcctctccctgatgcagatggcc
aagacctcggcggcactggcaaaactgaaggatgccggcctcccgttcatctccatcctg
accgatcccaccaccggcggcgtcaccgccagtttcgccatgctgggggacatcaacatc
gctgaaccgaaggcgttgatcggcttcgccgggccgcgggtcatcgagcagaccctgcgc
cagaagctgcccgacggcttccagcgcgccgaatacctgctggagcacggcatgctggac
gtgatcgtcccccgcacggagatgcgcgccaaactggcctcgatcctcggcatactgtac
cgccccgctgcctga

DBGET integrated database retrieval system