Pelobacter propionicus: Ppro_1745 Help Entry Ppro_1745         CDS       T00436                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppd  Pelobacter propionicus Pathway ppd00998   Biosynthesis of various antibiotics ppd01100   Metabolic pathways ppd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ppro_1745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ppro_1745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 DUF1246 Motif Other DBs NCBI-ProteinID:  ABK99357 UniProt:  A1APT7 LinkDB All DBs Position 1877430..1877663 Genome browser AA seq 77 aa AA seqDB search MSDIAKRVKEIVAEQLGVEESLVVPEASFMDDLGADSLDTVELVMALEEEFDIEIPDEDA EKIQSVNDAIEYITEHA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgacattgcgaaacgagtaaaagagattgtggctgagcagctgggcgtggaagag tcccttgttgtgcctgaggcttccttcatggatgatctgggtgccgactccctcgacact gtcgaactggtcatggctcttgaagaagaatttgatatcgagatcccggacgaagacgcc gagaagatccagtcggttaacgacgccattgagtatatcaccgagcacgcctag

DBGET integrated database retrieval system