KEGG   Pelobacter propionicus: Ppro_2481Help
Entry
Ppro_2481         CDS       T00436                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00020  Citrate cycle (TCA cycle)
ppd00190  Oxidative phosphorylation
ppd00650  Butanoate metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppro_2481
   00650 Butanoate metabolism
    Ppro_2481
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ppro_2481
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ppro_2481
    1.3.5.4  fumarate reductase (quinol)
     Ppro_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4 Fer4_18 Fer4_4 Fer2 Fer4_16 Fer4_6 Fer4_15 Fer4_2 Fer4_21 Fer4_3 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ABL00087
UniProt: A1ARW6
LinkDB All DBs
Position
complement(2687387..2688145)
Genome map
AA seq 252 aa AA seqDB search
MSDHKTMTLTLIVWRQKDASDPGKFETYTAKNITEHHSFLEMLDVVNEDLILAGKEPIAF
DHDCREGICGMCSQIINGAAHGGQERTTVCQLHMRKFKDGDTIYIEPWRARAFPIIKDLV
VDRTALDTIVQAGAYVSCHTGGVPDGNAILIPKPIADESMDAAECIGCGACVAGCPNGAA
MLFTGAKVSQFAVLPQGKGEAVTRVKALVKTMKECGFGNCTNHYECQAACPKGINVKFIA
RMNREFIKAQFA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcacaagacaatgacactgacactgatcgtgtggcgccaaaaggatgccagc
gatccgggaaagtttgagacctataccgctaagaacatcactgaacatcattcttttctg
gagatgctcgacgttgttaacgaagatctgatccttgccggcaaggagccgatcgcgttt
gaccacgactgccgcgaaggcatctgtggcatgtgttcccagatcatcaacggcgcagcc
cacggcggccaggagcggaccacggtttgccagctgcacatgcgtaagttcaaggatggc
gacaccatctacatcgagccctggcgtgcccgcgcgttccccatcatcaaggacctggtg
gtggaccgcaccgctctggataccattgtccaggccggcgcctacgtctcctgccacacc
ggcggcgtgcccgatggcaatgccatcctgattcccaagccgatcgctgacgagtccatg
gacgccgccgaatgtatcggttgcggcgcctgcgtggccggttgccccaacggagctgcc
atgctcttcaccggtgccaaggtttcccagttcgcggttcttccccagggtaagggtgag
gctgtgacacgcgtcaaggccctggtcaaaaccatgaaggagtgcggctttggtaactgc
accaaccattatgagtgccaggctgcctgcccgaaggggatcaacgtcaagtttatcgcc
cgcatgaaccgcgagttcatcaaggcacagttcgcctga

DBGET integrated database retrieval system