KEGG   Pelobacter propionicus: Ppro_2482Help
Entry
Ppro_2482         CDS       T00436                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00020  Citrate cycle (TCA cycle)
ppd00190  Oxidative phosphorylation
ppd00650  Butanoate metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppro_2482
   00650 Butanoate metabolism
    Ppro_2482
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ppro_2482
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ppro_2482
    1.3.5.4  fumarate reductase (quinol)
     Ppro_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO NAD_binding_8 GIDA HI0933_like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABL00088
UniProt: A1ARW7
LinkDB All DBs
Position
complement(2688145..2690061)
Genome map
AA seq 638 aa AA seqDB search
MILDGKCPTGPIQQTWDKHRFDLKLVNPANKRKYNVIVVGTGLAGGAAAASLGELGYNVQ
AFCYQDSPRRAHSIAAQGGINAAKNYPNDGDSIYRLFYDTIKGGDFRAREADVWRLAQVS
NNIIDQCVAQGVPFARDYAGYLDNRSFGGAQVSRTFYARGQTGQQLLLGAYTALSRQINA
GTVKMYNRREMLDLVVVDGVARGITVRNLITGEIESYAADAVCLATGGYVNVFYLSTNAM
GCSVTAIWKAHKKGAFFANPCYTQIHPTCIPQAGDYQSKLTLMSESLRNDGRCWVPKKKE
DCGKHPNEIPEDARDYYLERKYPSFGNLAPRDIASRAAKEACDDGRGVGPGGRGVYLDFA
ASIKRVGQPKIAERYGNLFEMYEKITDEDGYKRPMRMYPAPHYSMGGLWVDYNLMSNIPG
LFVLGEANFSVHGANRLGASALMQGLADGYFVIPYTIGGYLAGIKDPGTIKADHPEFRKA
EDDVKSSVNKYLSINGKKTTSEFMRELGSLMWENCGMARTKESLESNLQKIPALREEFWK
NVKVSGTGADFNQQLENAGRTADFLEFAELMCRDALHRNESCGGHFREEYQELGEAQRDD
VNYCYVGAWEYKGVGKEPELHKEPLKFDNVHLAIRSYK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgatacttgatggaaaatgtcctactggacctattcagcaaacctgggacaagcaccgc
ttcgatctgaagctggtcaatcctgccaataagcgtaaatataacgtcatcgtggtcggt
accggtctggccggtggcgccgccgccgcttcgctcggtgaactgggctacaatgttcag
gccttctgttatcaggattcccctcgccgcgcgcactccatcgccgcacagggtggtatc
aacgctgccaagaactatcccaatgacggtgactccatctaccggctgttctacgacacc
atcaaggggggcgacttccgcgcccgtgaagccgacgtctggcgtctggcccaggtgtcc
aacaacatcatcgaccagtgcgtcgcccaaggcgttccctttgcccgcgactatgccggc
tacctggataaccgctccttcggtggcgcccaggtttcccgtaccttctacgcccgtggc
cagaccggtcagcagctcctcctgggcgcctacaccgccctgtcccgccagatcaacgcc
ggtacggtcaagatgtacaaccgccgcgaaatgctcgatctggtggtggttgacggcgtt
gcccgcggtattaccgtccgcaacctgatcaccggcgagatcgaaagctatgcagccgat
gccgtctgtttggcaaccggtggctacgtcaacgtattctacctctccaccaacgccatg
ggctgctcggttaccgccatctggaaggcacacaagaagggcgccttcttcgccaacccc
tgctacacccagattcacccgacctgtatcccccaggccggcgactaccagtccaagctg
accctgatgtccgagtcgctgcgtaacgacggacgctgctgggttcccaagaagaaagag
gactgcggcaagcatcccaacgagatcccggaagatgcccgtgactactacctggagcgc
aagtacccctcattcggtaacctggctccccgcgacatcgcctcccgcgccgccaaggaa
gcctgcgacgacggtcgtggcgtcggccccggcggccgtggtgtgtacctggacttcgcc
gcttccatcaagcgcgtcggccagccgaagatcgccgagcgttacggcaacctcttcgaa
atgtacgagaagatcaccgacgaggacggttacaagcgtcccatgcgtatgtaccccgcg
ccgcactactccatgggcggcctgtgggtcgactacaacctgatgagcaatatccccggc
ctgttcgtcctcggtgaggcaaacttctccgtgcacggcgccaaccgtctgggtgcttcc
gctctcatgcagggtcttgccgacggctacttcgtcattccttacaccatcggcggctat
ctggccggcatcaaggatccgggcacgatcaaggccgaccatcccgagttcaggaaggcc
gaggacgacgtcaagtccagcgtcaataaatacctctccatcaatggcaagaagacaact
tcggagtttatgcgcgaactgggttccctgatgtgggaaaactgcggtatggctcgcacc
aaggaatccctggagtccaacctgcagaagattcctgcactgcgcgaagagttctggaag
aatgtcaaggtgtccggtaccggtgctgacttcaatcagcagctggaaaacgccggccgc
accgccgacttcctcgagttcgccgagctcatgtgccgcgatgccctgcaccgcaacgaa
tcctgcggtggccacttccgcgaagagtatcaggaacttggcgaagcccagcgtgacgac
gtcaactactgctatgtcggcgcgtgggagtacaagggcgttggcaaagagcccgagctg
cacaaagagcctttgaagtttgataatgtacatcttgccataaggagctacaagtaa

DBGET integrated database retrieval system