KEGG   Pelobacter propionicus: Ppro_2545Help
Entry
Ppro_2545         CDS       T00436                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00550  Peptidoglycan biosynthesis
ppd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ppro_2545
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Ppro_2545
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ppro_2545
Peptidoglycan biosynthesis and degradation proteins [BR:ppd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Ppro_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Nuc_rec_co-act MoeA_C
Motif
Other DBs
NCBI-ProteinID: ABL00150
UniProt: A1AS29
LinkDB All DBs
Position
complement(2758379..2760307)
Genome map
AA seq 642 aa AA seqDB search
MKEKRFVREFMEMKQRTVLLSFMVAAIFFLLLLRLWHLQILNADDYRSKSEDNRLRFVPI
AASRGAIMDRNATVLVSNQPSFSLAVVPQEVKDKEALLDQLVSLLGVDREELAERWKKGQ
GRARYYPIVLAANITRDQVEIIEENHLRLPGVEIEVKPVRQYASGMLASHLMGYIGEVSE
DELSRKGNEAYNPGDYIGKNGIERAWEAVLHGRDGGRQLEVDARGRVLRTISETQPLVGN
SVVLTIDARIQQGAESAFGEQAGAAVAMDVNSGEILAFVSNPGFDPALFSGKMPPDVWKQ
YLEDKRRPLENKALSGQYPPGSTFKIITALAGLENNLVDENSSVSCSGAYRMGTSTFKCW
NRHGHGSVNLKKSLRESCDVYYYHLGERLGVDRIAATARQFMLGSPMGIGLKHEKGGLIP
SIAWKQKRFGKAWIRGETPSVSIGQGYVLMTPIQLASMIATVANEGTIYRPQLVKRIVDA
DGRTLREFGPERIGTTGISARSFRLVKQGLFAVVNERGGTGGAARVGYVTVAGKTGTSQV
VKLRDSRGGIPYQYRDHALFVAFAPFEKPEIAVAVVIEHGEHGGSAAAPIAGRIIRTWYE
TKHPPKPVARPVAEKETEAEEETDEAPATEQQPHPDGEERND
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaacgtttcgtccgtgaattcatggagatgaagcaacgcaccgttctgctc
tccttcatggttgccgccatcttcttcctgctgctgctgcgcctctggcacctgcagata
ttgaacgccgatgactaccgcagcaagtccgaggacaaccggttgcgcttcgtgcccatt
gccgcctcccggggcgcgatcatggaccgcaacgctacggtgctggtcagcaaccagccc
tccttcagcctggcggtcgtcccccaggaggtgaaggacaaggaggccctgctggaccag
ctggtctcgcttttgggggtcgaccgggaggagcttgccgagcgctggaagaaggggcag
gggagggccagatactacccgatcgtgctggccgccaacatcacccgcgaccaggtggag
atcatcgaggagaaccatctgcgtctgccgggggtggagatcgaggtcaagccggtgcgg
cagtatgccagcggaatgctggcttcgcacctgatgggctacatcggcgaggtttccgag
gacgaactttcccggaaggggaacgaggcatacaaccccggcgactacatcggcaagaac
ggtatagaacgggcctgggaggcggtgctgcacggccgtgacggcggccggcagcttgag
gtggatgcccgcggacgggtcctgcggaccatctccgagactcagcccctggtgggcaac
agcgtggtgctgaccatcgacgccaggatccagcagggggccgagagcgccttcggtgaa
caggcgggcgcagcggtggccatggatgtgaacagcggcgagatcctggcctttgtcagc
aatccgggctttgatcccgccctgttcagcggcaagatgccgccggatgtctggaaacag
tacctggaggacaagcgccgtcccctggagaacaaggccctgagcggccagtatcccccc
ggctccaccttcaagatcatcaccgccctggccggcctggagaacaatctggtcgatgaa
aacagcagcgtcagctgctccggcgcctacaggatggggacctccaccttcaaatgctgg
aacaggcacggccacggaagcgttaacctgaaaaagtccctgcgtgagtcgtgcgacgtc
tattactaccatctgggagaacggctgggggtggaccgcatcgccgccacggccaggcaa
ttcatgctcggctcgcccatgggcatcggcctgaagcacgaaaaaggggggctgatcccc
agcatcgcctggaagcagaagcgcttcgggaaagcgtggatccgcggtgaaaccccctcg
gtgtccatcggccaggggtatgtgctgatgacgcctattcagctggcctccatgatcgcc
actgtggctaacgaggggacgatctaccgtccccaactggtgaaacggatcgtcgatgcc
gatggcaggacgctcagggagttcgggccggaacgcatcggaaccaccggcatatcggcg
cgcagcttccgcttggtgaaacaggggctcttcgccgtggtgaacgagcggggcggtacc
ggcggcgcggcgcgtgtcggctatgtgacggtggccggaaagaccggtacctcccaggtc
gtaaagctgcgcgacagccggggaggaatcccctaccagtatcgggatcatgccctgttc
gtggcctttgccccctttgagaagccggaaatcgccgtggcggtggtcatcgaacatggc
gagcacggcggttccgccgccgcgcccatcgccgggcgcatcatacggacctggtacgag
acaaagcatccccccaaaccggtggcccgccctgtggctgagaaagaaacggaggccgaa
gaggagacggacgaggctccggcgacggaacagcagccacacccggatggggaggaacgc
aatgattga

DBGET integrated database retrieval system