KEGG   Pelobacter propionicus: Ppro_2559Help
Entry
Ppro_2559         CDS       T00436                                 

Definition
(GenBank) dihydroxyacid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00290  Valine, leucine and isoleucine biosynthesis
ppd00770  Pantothenate and CoA biosynthesis
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01130  Biosynthesis of antibiotics
ppd01210  2-Oxocarboxylic acid metabolism
ppd01230  Biosynthesis of amino acids
Module
ppd_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Ppro_2559
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ppro_2559
Enzymes [BR:ppd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Ppro_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD DUF1134
Motif
Other DBs
NCBI-ProteinID: ABL00164
UniProt: A1AS43
LinkDB All DBs
Position
complement(2771890..2773551)
Genome map
AA seq 553 aa AA seqDB search
MRSDTITQGFERTPHRALLKGSGVPQSQMDKPFIGVATSFTDLIPGHVGMRDLERFIEKG
VHTGGGHAFFFGLPGVCDGIAMGHKGMHYSLPTRELIADMVESVAEAHRLDGLVLLTNCD
KITPGMLMAAARLDIPCIVVTAGPMMSGRGQEGRKFSFVTDTFEAMARYKAGVISERELM
VCEENACPGIGSCQGLFTANTMAILTETMGMSLPRCGTALAVSALKRRIAFASGEKIVEL
VQNNITPRSILTREAFENAIRVDLALGGSSNTVLHLLAIANEAGVELPLETFDILAKETP
QLASMNPAGEHFMEDLDVAGGVSGVMKQLGDKIKDTQTLFGLTTRQLAASVENVDETVIR
PLTNPVKKEGGIAVLFGNIAPKGAVVKQSGVSDKMMKFEGTARCFDSEELAMAALMEGEI
VAGNVVVIRYEGPKGGPGMREMLAPTAALMGLGLGDSVALITDGRFSGGTRGPCIGHISP
EAAQGGPIGLIQDGDRISLDIPARRLELLVDEAVLQARAATWVAPPPKIAKGWLARYAKV
VTSAHTGAVTTAE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgatacgattacacaagggtttgaacgcactccgcaccgcgccctgctgaag
ggtagcggtgtcccacagagtcagatggacaagccgttcatcggcgtggccaccagcttt
accgacctgattcccgggcacgtgggcatgcgcgacctggagcgcttcatcgagaagggg
gtccacaccggcggcggccacgccttcttcttcggcctgcccggcgtgtgcgacggcatc
gccatggggcacaaggggatgcactactccctgccgacccgcgagcttatcgccgacatg
gtggagtcggtggccgaagcccaccgcctggacgggctggtgctgctgaccaactgcgac
aagatcacccccggcatgctcatggccgccgcccggctggatatcccctgcatcgtggtc
accgccggtcccatgatgagcggccgcggccaggaagggcgcaaattctcctttgtcacc
gataccttcgaggccatggcccgctacaaggccggcgtgatcagtgagagggaactgatg
gtctgcgaggagaacgcctgccctggcatcggctcctgccaggggctgttcaccgccaac
accatggccatcctgaccgagaccatgggcatgagcctgccgcgctgcggcacggccctg
gcggtgtcggcgctgaaacggcgcatcgcctttgcctcgggggagaagatcgtggagctg
gtgcagaacaacatcaccccgcgcagcatcctgacccgcgaggccttcgagaacgccatc
cgggtggacctggccctgggcggctcctccaacaccgtgctgcacctgctggccatcgcc
aacgaagcaggggttgagctgccgctggagaccttcgacatcctggccaaggagaccccc
caactggcatccatgaacccggccggcgagcacttcatggaggacctggacgtggccggc
ggcgtcagcggcgtcatgaagcagctgggcgacaagatcaaggatacgcagaccctgttc
ggcctgaccaccaggcagctggcagccagcgtggagaacgtggacgagacggtgatccgt
ccgcttactaacccggtgaagaaggaggggggcatcgcggtcctgttcggcaacatcgcg
cccaagggggcggtggtcaagcagtccggcgtgtcggacaagatgatgaaattcgagggg
acggcgcgctgcttcgactccgaggagctggccatggccgccctgatggaaggggaaatc
gttgccggtaatgtggtggtgatccgctacgaggggcccaagggtggccccggcatgcgc
gagatgctggctcccaccgccgccctgatggggcttggtttgggggactcggttgccctg
atcaccgacggccgtttctccggcggcacccgtggtccctgcatcggccacatctccccc
gaggcggcccagggcggccccatcggcctgatccaggacggcgaccgcatctccctggat
atcccggctcgcaggctggagctgctggttgatgaggctgtgctgcaggcacgcgcagct
acctgggtggctcctccccccaagattgccaaggggtggctggcccgctacgccaaggtg
gttacctcggcccacaccggcgcggtgactacggcggagtag

DBGET integrated database retrieval system