KEGG   Pelobacter propionicus: Ppro_3089Help
Entry
Ppro_3089         CDS       T00436                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00970  Aminoacyl-tRNA biosynthesis
ppd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ppro_3089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppd03029]
    Ppro_3089
Enzymes [BR:ppd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ppro_3089
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ppro_3089
Mitochondrial biogenesis [BR:ppd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ppro_3089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABL00685
UniProt: A1ATL4
LinkDB All DBs
Position
3378162..3379601
Genome map
AA seq 479 aa AA seqDB search
MKYQAVIGLEVHVQLKTDSKIFCGCSTSFGSDPNSQTCPVCLGLPGALPVLNKKVVEFAI
KAGLATNCSITQRSIFARKNYFYPDLPKGYQISQFEDPVCQWGWLDIELNGETKRIGITR
IHMEEDAGKLVHADVPELEDGSGVDLNRACTPLLEVVSEPDLRSSDEAVSYLKQLHQIVT
WLGICDGNMEEGSFRCDANVSVMEQGAEKFGTRAEIKNINSFRFVKQAIEYEIQRQIDLI
EDGGTVVQETRLFDPDNGVTRSMRSKEEAHDYRYFPDPDLVPLVIDDDWIQRVRQGLPEL
PEHKKQRFMSEFSIPAYDAEVLTASRPLAEYYEECVACHHDGKAVSNWVMGEVTRGLNDS
GLSIENCPVTPRLLGGLLKLMDNGTISGKIAKTVFDEMWKSGKEPAVIVEEQGLVQVSDN
GAILAIIDEIMAKNQGQVAEYRSGKDKLFGFFVGQVMKASKGKANPSLVNELLLEKLKG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaagccgttatcggacttgaggttcacgtccagctcaagaccgactccaag
atattctgcggatgctccacctccttcggatccgaccccaactcccaaacctgcccggtc
tgtctggggctgcccggggcactgccggtgctgaacaaaaaagtggtggaattcgccatc
aaggccggtctggccaccaactgctccatcacccagcgcagcatcttcgcccgcaagaac
tacttctatccggacctgcccaagggataccagatcagccagttcgaggatcccgtctgt
cagtggggctggctggatatcgagctgaacggcgaaaccaagcgcatcggcatcacccgc
atccacatggaagaagacgccggcaagctggtgcacgctgacgtccccgagctggaggac
gggtcgggcgtggacctgaaccgggcctgcacaccgcttctggaggtggtctccgaaccg
gacctgcgctcatccgacgaggcggtcagctatctcaagcagctgcaccagatcgtgacc
tggctcggtatctgcgacggcaacatggaggaggggagcttccgctgcgacgccaatgtc
tcggtcatggagcagggggccgagaaattcggcacccgcgccgagatcaagaacatcaac
tccttcaggttcgtcaagcaggccatcgaatacgaaatccagcgccagatcgacctgatc
gaggatggcggcacggttgtccaggaaacacgcctgttcgatcccgacaacggcgtgacc
cgctccatgcgcagcaaggaggaggcccacgactaccgctacttccccgatcccgacctg
gtgccgctggtaatcgacgacgactggatccagcgggtgcgccagggcctgcccgaactg
cccgagcacaagaagcagcgcttcatgagcgagttcagcatccccgcctatgacgccgaa
gtgctcaccgccagccgtcccctggccgaatactatgaggagtgcgtggcctgccaccac
gacggcaaggcggtttccaactgggtcatgggcgaggtcacccgcggactgaacgacagc
ggactctccatagaaaactgcccggtcaccccccggctactggggggactgctcaagctg
atggataacggcaccatctccggcaagatcgccaagacggtcttcgacgagatgtggaag
agcggcaaagagccggccgtcatcgtggaggagcagggactggtccaggtttccgacaac
ggagccatcctggccatcatcgacgaaatcatggccaaaaaccagggacaggtggctgag
taccgcagcggcaaggacaagttgttcgggttctttgtcggccaggtcatgaaggccagc
aagggcaaggccaacccctccctggttaacgagttgctgctggagaagctgaagggatag

DBGET integrated database retrieval system