KEGG   Pelobacter propionicus: Ppro_3415Help
Entry
Ppro_3415         CDS       T00436                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00500  Starch and sucrose metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ppro_3415
Enzymes [BR:ppd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Ppro_3415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ABL01008
UniProt: A1AUI7
LinkDB All DBs
Position
3775590..3778154
Genome map
AA seq 854 aa AA seqDB search
MDFSKMLHTFSVVPSLSGDLSPLQRIAYNLWWCWEPDAINLFRRMDADLWQATRHNPVEM
LGILQQTTLETLQSDEGFMAHLKMVDEKLDDYLQEKTWFQKNADGHSTMKVAYFSMEYGL
HESIPIYSGGLGILAGDHLKSASDLGIPLVGVGLLYRQGYFRQYLNNEGWQQEYYPENDF
YNLPLVLERDDSGTPHTIELEFGPRKFLARIWRVQVGRVPLYLLDTNLEENSPEDRLITA
KLYFGDQEMRMLQEILLGIGGIRALRTMGILPNICHMNEGHAAFLALERIRLLMERRDVD
FSEAREIVRAGNVFTTHTPVEAGIDHFPESLLEKYFGRYYHSLGLSSNEFFGLGRQNPKN
HQESFCMAVLALKLASHANGVSQLHGEVSRKMWRNIWPELPDEQLPLTYVTNGVHTRTWM
SYQMSSLLVRYLGNRWRDDPADHGAWRRIARIPDAELWRTQQSCREKLVDFARKRLKQQL
VKVGATLKEISIAEEVLDPEVLTIGFARRFATYKRGTLLLRDLDRLARILNNPEMPVQII
FAGKAHPQDHEGKELIRQIVQVSHQERFRHRIVFIEDYDMEVARHLVQGVDVWLNTPLRP
MEASGTSGMKVAFNGGLNMSVLDGWWCEGYQRNNGWAIGKGEVYEDTEYQNQVEGRAVYD
LLEKEVVPHFYERGSDGIPRAWVGTMKASLQSLCPVFSTERMVQEYTTTTYIPSYAQWNR
LVADDLALALDLARWKERIFKAWPQVRIEHAEAQVSEAVAVGSSIPIGARVALGELELDE
VAVEGYFGVLDSTGVIQGGESVTLEHVSALGNAVHQFAGRIECRFCGRHGFMLRVMPRHK
LLGPIYEPGYLLWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggatttcagcaagatgctgcacaccttttccgtggtcccctccctgtccggcgacctt
tctccgctccagcgcatcgcctacaacctgtggtggtgctgggaaccggacgccatcaac
ctgttccgccgcatggatgccgacctgtggcaggccacccgccacaacccggtggagatg
ctgggaattctgcagcagaccaccctggaaacgctgcagagcgacgagggcttcatggcc
cacctgaagatggtggacgagaagctggacgactatctccaggaaaagacctggttccag
aagaacgcagacggccattccaccatgaaggtcgcctatttttccatggaatacgggctg
cacgaatcgattccgatctactccggcggcctgggcatcctggccggcgatcacctcaag
tctgccagcgatctggggatcccgctggtgggggtgggactgctctaccgccaggggtat
ttccgccaatacctgaacaacgaggggtggcagcaggagtactacccggagaacgacttc
tacaacctgcccctggtgctggagcgggacgacagcgggactccccataccatcgaactg
gagttcggcccccggaaatttctggcccgcatctggcgggtgcaggtcggccgggtgccg
ctctatctgctggacacgaacctggaggagaacagccctgaagaccggctgatcacggcc
aagctctacttcggcgaccaggagatgcgcatgctgcaggagatcctgctggggatcggc
ggcatccgtgccctgcggaccatgggcattcttcccaatatctgccatatgaacgaagga
cacgccgcttttctggctctggagcgtatccgcctgctgatggagcggcgcgacgtggac
ttcagcgaggcccgcgagatcgtccgcgccggaaacgtgttcaccacccataccccggtg
gaagcgggcatcgatcacttcccggagtcgctgctggagaagtacttcggccgctactac
cactccctcggcctgagcagcaacgaattcttcggcctggggcgccagaaccccaaaaac
caccaggagagcttctgcatggcggtcctggcgctgaagctggccagccacgccaacggc
gtcagccagttgcacggcgaggtgtcgcgcaagatgtggcgcaacatctggccggaactg
cccgatgagcagctgccgctaacctacgttaccaacggcgtccatacccgcacctggatg
tcctaccagatgagcagcctgctggtgcgctacctgggaaaccgctggagggacgacccg
gccgatcacggcgcctggcgacggatcgccaggattcccgacgcggagctgtggcggacc
cagcagagctgccgtgaaaagttggtggattttgcccgcaaacgcctgaaacagcagctg
gtcaaggtgggggccaccctgaaggagatctccattgccgaagaggttctggacccggag
gtgctgaccatcggttttgcccggcgcttcgccacctacaagcggggcacgctgctcctg
cgcgacctggaccgcctggcccgcatcctgaacaacccggagatgccggtgcagatcatc
tttgccggcaaggcccatccccaggaccatgaggggaaggagctgatccgccagatcgtg
caggtctcccaccaggaacgcttccgccaccgcatcgtgttcatcgaggactacgacatg
gaggtggcccgccacctggttcagggtgtggatgtctggctcaacaccccattgcgcccc
atggaggccagcggcaccagcggcatgaaggtggcctttaacggcggcctgaacatgagc
gtgctggacggctggtggtgtgagggataccagcgcaacaacggctgggcaatcggcaag
ggcgaggtatacgaggatacggagtaccagaaccaggtggagggacgcgccgtctatgac
ctgctggaaaaggaggtcgtgccgcacttctatgagcgggggagcgacggcataccccgt
gcctgggtcggcaccatgaaggcatccctgcagagcctctgtccggtattctccaccgag
cgcatggtacaggagtacaccacgaccacctacatcccttcctatgcgcagtggaacaga
ctggtggcggacgatctggccctggccctggacttggcccgctggaaggagcgcatcttc
aaggcctggccccaggtacgcatcgagcatgccgaggcacaggtttccgaggcggtggcg
gtggggagcagcattcccatcggcgccagggtggccctgggcgaactggagttggacgag
gtggccgtggaggggtacttcggcgtgctggattccaccggcgtcatccaggggggggag
agcgtcacccttgaacatgtcagtgccctgggcaatgccgtgcaccagttcgccggccgg
atagagtgccgcttctgcgggcgccacggcttcatgctgcgcgtcatgccgcgccacaaa
ctgctgggccctatctatgaacccggctatctgctctggggatag

DBGET integrated database retrieval system