KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0404
Entry
PEPE_0404         CDS       T00409                                 

Definition
(GenBank) Superfamily I DNA and RNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
ppe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_0404
   03430 Mismatch repair
    PEPE_0404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_0404
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PEPE_0404
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PEPE_0404
   MMR (mismatch excision repair)
    Other MMR factors
     PEPE_0404
SSDB
Motif
Pfam: AAA_19 Viral_helicase1 UvrD-helicase UvrD_C_2 UvrD_C DUF2075 AAA_30 DUF4351 NACHT PhoH DEAD
Other DBs
NCBI-ProteinID: ABJ67500
UniProt: Q03H22
LinkDB
Position
449829..452126
AA seq 765 aa
MAEGIFEYENRHLDEVLDKVDTAIAKAENDADNAEKDRSAIDKNFYNDVRINTSSYSGMM
DTAISIRQQQQLLSERENSWQHANKRLTTFKEMKKRPYFARIDFHEKGEKKDETIYIGLA
SFSDTADHFLIYDWRAPISSVYYDGKMGDVEYATPDGTQTVDLKLKRQFTIEDGKLISVY
DTDETIGDQMLLNALGSQSDVKMKSIVSTIQREQNKIIRNTAADLLFVQGAAGSGKTAAI
LQRVAFLLYRYRGNLNAGQVIMFSPNQLFNDYVDQVLPELGEQNMIQMTYYQFTRRRIPN
IDVENLQQRFDKKLTDAERKIEQFKGSLQFFKATTKYAKYLGTAGMRFRNIMFQGQPFAT
KEKIKDIYYSFNTTYNLGNRIEGTREALIRQLNQKVGSELRTKWVEEAVQNLSQEELHNL
FKNEPREFKDNDEEFKFLARQIVMKELKPVRNAIMRNRFLSINAQYVQMLRSFPKWYDLK
KVGVTEAEWDNHVDKVVNGLKEHQLTMVDTTAYLYLYDLITGKKGDRSMRYAFIDEIQDY
NAFQLAYIRFNFPRAKFTLLGDLNQSIYANETSDTLLAELSTMFDPEKTEVVQLSKSYRS
TQQITDFTKEILVKGEAIESFNRAGELPTVSINSSHQGMVEAVIEQLHRDRQDHETSAII
GRSYAECEQIADELKAAGEQVTLIRTENQRLVEGTIVVPSFLAKGLEFDSVIVWNTSAKI
YQTNRDEQLLYTICSRAMHRLLIVAENDLSPLITKIPENLYIKKA
NT seq 2298 nt   +upstreamnt  +downstreamnt
ttggcagagggaatttttgaatacgaaaatagacatttagatgaagttttagataaggtg
gatactgcaattgccaaagcagaaaacgacgccgataatgccgaaaaagatcgtagtgcg
attgataagaatttttacaacgatgttcgaattaacacttccagttattcaggtatgatg
gatactgcaatttcaatccgtcaacaacagcaattattatctgaacgcgaaaatagttgg
caacacgctaataaacgtttaaccacgtttaaagaaatgaaaaagcggccctattttgca
cgaattgattttcacgaaaaaggtgaaaagaaggatgaaaccatctatattggtttagct
tcattttcggacacggccgatcattttttgatttatgattggcgggctcccatttctagt
gtttactatgacggaaaaatgggcgatgtggaatatgcaacgccagatggcacgcaaacg
gtagacttgaagttaaaacggcaatttactattgaagatggtaaattgatttcagtttac
gatacggacgaaactatcggagatcaaatgctactaaacgcgttgggttctcaatccgat
gttaagatgaaaagtattgtttcaaccatccaaagagaacagaataaaattattcgaaat
accgcagccgatttactattcgttcaaggtgcagctggatcgggaaagaccgctgcgatt
ttacagcgggtcgctttcttgctttaccgttaccgcggaaatttaaatgctggacaagtc
atcatgttttcacctaatcaattgtttaatgattatgttgatcaagttttacccgaactg
ggcgaacaaaacatgattcagatgacctattatcaatttactagacgacggattccaaac
atcgacgttgaaaacttgcaacaacgttttgataagaagctcacggatgcggaacgtaaa
atcgaacaattcaaaggaagcttgcaatttttcaaagctactactaaatatgcgaaatat
cttgggacggcaggtatgcgattccgcaatatcatgttccaaggtcaaccgtttgctact
aaggaaaaaattaaagacatctattattcatttaatactacctataatttgggtaaccga
attgaaggaactcgggaagccttgatccgccaattgaaccaaaaagtaggtagtgaattg
agaactaagtgggtggaagaagcggtccaaaaccttagccaagaagaattacacaaccta
tttaaaaacgagccccgtgaatttaaggataatgatgaagaatttaaattccttgctcgt
caaatcgtaatgaaagaacttaaaccggttcgaaatgcgattatgcgtaatcgcttctta
agcattaatgcccaatatgtccaaatgctacgttcgttccccaaatggtacgatttaaag
aaagttggggtaacagaagcagaatgggataaccatgtggataaagtggtaaatggactt
aaggagcatcagttaaccatggtagatacaaccgcttatttatacttgtatgatttaatt
acgggtaaaaaaggtgatcgttccatgcgttatgcatttattgatgaaatccaagattat
aatgctttccaactagcttatattcggttcaattttcctcgagcaaaattcacactttta
ggagatttaaatcaatcaatttacgccaatgaaactagtgatactttattagcagagtta
tcaacaatgtttgatccagaaaagacggaagtagttcaactatctaagtcttatcgttca
acacaacaaattacagactttactaaggaaatcttggtcaaaggtgaagcaattgaatcc
tttaatcgcgcgggtgaattaccaacggtttcaattaatagtagtcatcaaggaatggtt
gaggcggtgatcgaacagcttcatcgcgatcgccaagatcatgagactagcgccattatt
gggcgtagctatgctgaatgtgaacaaatcgcggatgaattaaaagcagctggcgagcaa
gtaacgctaatccgaactgaaaatcagcgtttggtggaaggtaccatcgttgttccatct
ttcttagccaagggattggaatttgattcagtaatcgtgtggaatacttcagcgaagatt
tatcaaactaatcgggatgaacagttattatatacaatttgttcacgggcaatgcatcga
ctcttaatcgttgctgagaatgatcttagtccgttaattactaagattcctgaaaattta
tatattaaaaaagcttaa

DBGET integrated database retrieval system