KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0448
Entry
PEPE_0448         CDS       T00409                                 

Definition
(GenBank) Excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_0448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_0448
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PEPE_0448
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      PEPE_0448
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 AAA_7 AAA_19 AAA T2SSE DUF2252 Kinesin UB2H AAA_16 AAA_25
Other DBs
NCBI-ProteinID: ABJ67544
UniProt: Q03GX8
LinkDB
Position
497678..499681
AA seq 667 aa
MIKRENDREFELVSKYQPTGDQPTAINELVDGIKSGEKEQILLGATGTGKTFTISNVIQK
VNKPTLILSHNKTLAGQLYGEFKQFFPNNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSI
NDEIDELRHSATSSLLERNDVIVVASVSSIFGLGDPREYQDQALTLRVGQEIDRNKLLRE
LVDIQYDRNDIDFQRGRFRVHGDVVEIFPAANDAHSIRVEFFGDEIDRMREMDALTGEII
GDRDHITIFPATHFMTNEDRMEHAIKNIEAELKDRLEELDGEGKLLEAQRLRQRTTYDIE
MLKEMGYTNGIENYSRHMDGRKPGEAPYTLLDFFPDDFLLVVDESHVTMPQVRGMYNGDR
ARKQQLVDYGFRLPSALDNRPLKLEEFEKHINQVVYMSATPGDYENERTNNVVQQIIRPT
GLLDPIIEVRPIMGQMDDLLGEINQRIEKDERVFVTTLTKKMAEDLTDYLKDMGIKVAYL
HSDIKTLERTRIIRDLRVGKYDVLVGINLLREGIDVPEVSLVAILDADKEGFLRNTRSMI
QVAGRAARNENGHVIMYADHMTKSMQETIDETARRRTIQEAYNREHGITPHTIKKDIRSL
ISSTSDTEDKGKKDDFLDVDFADMDSKDQKEMIANLEDQMRAAAKKLDFEKAANLRDTVL
ELKAQIG
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgattaaacgtgagaatgatcgtgaatttgaattggtttctaagtaccaaccaacgggg
gatcagccaacggcgatcaacgaattagttgacggtattaaaagtggcgagaaagaacaa
atcctgttgggtgcaacgggtaccgggaaaacttttacgatttctaacgtaattcaaaaa
gtgaataaaccaactttaattttgtcacacaataaaactttggcgggccaattatatggc
gagtttaaacagtttttcccgaataacgcggtagaatattttgttagttattatgattat
tatcagcctgaagcatacgttccatctagtgacacttatattgaaaaagactcatcaatc
aatgatgaaatcgatgagctccgccattccgctactagttcactacttgaacgcaatgat
gtgattgtggtggcttctgtttcaagtatctttggtttgggtgatcctcgagaataccaa
gatcaagccttaacacttcgagtagggcaggagattgatcgaaataagttactacgagaa
ttagttgatattcagtacgaccgtaatgatattgatttccagcgtggccgttttcgggtg
catggcgatgtagttgaaatttttccggctgctaatgatgcgcattccattcgagtagaa
ttctttggggatgaaattgatcgaatgcgtgaaatggatgccttaacgggagaaattatt
ggtgatcgagatcatattacaattttcccagcaacccattttatgactaacgaagatcga
atggaacatgcgattaagaacattgaagcggaattgaaggaccgtttggaagaattagat
ggtgagggaaaactcctagaagcgcaacgtttacgacaaagaacgacctatgatatcgag
atgttaaaagaaatgggatacaccaacgggattgaaaattattccagacatatggatggt
cgtaaaccaggtgaagcaccttatactttactagatttcttccccgatgattttctattg
gtcgtagatgaatcccacgtaactatgccacaagtacgcggtatgtacaatggggatcga
gctcgtaagcaacaattagtagattacgggtttagattgccaagtgcgttggataaccga
ccccttaaattagaagaatttgaaaaacatattaaccaagtggtttatatgtcagctacc
ccaggtgattatgaaaatgaacgaactaataacgttgttcaacagattattcgaccaact
gggttattggatccaatcatcgaagtacgcccaatcatgggccaaatggatgatttgcta
ggtgaaattaatcaacggattgaaaaagacgagcgtgtatttgtaacaactttgacgaag
aagatggccgaagatttaaccgattatctgaaagatatgggaattaaggttgcttacttg
catagtgatattaagacgctggaaagaacccgtattatccgtgatttacgggtaggcaag
tatgatgttttagtaggaatcaatttgcttcgtgaaggaattgatgttccggaagtatct
ttagtagcgattttagatgccgacaaggaaggtttccttcgaaatactcgttcgatgatt
caggtggctgggcgtgcggcacgtaatgaaaatggacacgttattatgtatgctgatcat
atgactaagtccatgcaagaaaccattgatgaaactgcacgacgtcgtacgattcaagaa
gcatataaccgtgaacatggaattactcctcatacaattaaaaaggatattcgttcgttg
atttcatcaaccagtgatactgaggataaaggtaaaaaagacgacttcttggacgttgat
tttgccgacatggatagtaaggatcaaaaagaaatgattgcaaacttggaagatcaaatg
cgagcggctgctaagaagctagacttcgaaaaagcagctaacttgcgagataccgtttta
gaattaaaagcacagattggttag

DBGET integrated database retrieval system