KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0449
Entry
PEPE_0449         CDS       T00409                                 

Definition
(GenBank) Excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_0449
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_0449
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PEPE_0449
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      PEPE_0449
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA_15 DnaJ_CXXCXGXG AAA_14 AAA_23 AAA_33 AAA_25 APS_kinase AAA_21 AAA_18 MMR_HSR1 NACHT T2SSE Viral_helicase1 cobW AAA_24 DUF87 NTPase_1 MeaB NB-ARC Septin
Other DBs
NCBI-ProteinID: ABJ67545
UniProt: Q03GX7
LinkDB
Position
499694..502537
AA seq 947 aa
MANDKIVIHGARAHNLKNIDVTIPRDKLVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDYLRLLWARVGQP
ICPNDGTPITSQTVEQMVNRVLDLPERSKVQIISPIVRAKKGQHKKVFEKIKREGFVRVR
VDDETMDVEEVPELDKNKVHTIDIVVDRVVVKDGIRSRLFDSFEAALRLSKGYATADVIG
GEPILFSEHYSCPVCGFTVGELEPRLFSFNAPFGACPECDGLGIKLEVDEDLVIPDPSKT
LREGAIAPWNPISSQYYPTLLEQAAKSFGIDMDTPFEDLPKADRQLVLYGSKGKKFHFHY
ENDFGGVRDVDSVFEGVMVNIDRRYHETNSDFTRDQMRLYMRELTCQTCHGYRLNRKALS
VKIDGKHIAEISALPIDSAMEFFGNLNFSEQDTAVATPILKEIKDRLNFLRNVGLEYLTL
SRSARTLSGGEAQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNNRLISSLKKMRDLGNT
LVVVEHDEDTMWAADYLIDIGPGAGENGGEVMAAGTPKQVAKSRKSLTGKYLSGKKFIPV
PETRRTGNGQSIKLKGVQENNLKNIDVDFPLGEFVAVTGVSGSGKSTLVNMVLKRVLAQK
LNHNSEKPGKYKSVSGIKNIEKVINIDQSPIGRTPRSNPATYTSVFDDIRGLFAQTNEAK
LRGYTKGRFSFNVKGGRCEACKGDGILKIEMNFLPDVYVPCEVCHGTRYNSETLEVKYKG
KTIADILDMTVEEATDFFAPIPKIARKLQTIIDVGLGYVHLGQSATTLSGGEAQRMKLAS
ELHKKANGKNFYILDEPTTGLHTDDIKRLLDVLQRLVDNGNTVLVIEHNLDVIKTADHLI
DLGPEGGAGGGQVVAVGTPEAIAAVPESYTGKYLKEVLERAQELSQK
NT seq 2844 nt   +upstreamnt  +downstreamnt
ttggcaaatgataaaattgttatccacggtgcacgagcacataatttaaagaatattgat
gttaccattccacgcgataaactagtggtggtgacagggttatctggatcaggaaagagt
tcattggcttttgataccctctatgctgaaggtcaacgacgctacgtagaaagtttgtca
gcgtatgctcgtcaatttttagggcaaatggataagccagatgttgattcaattgatgga
cttagtccggctatttcgattgatcaaaagacaacttctaaaaatcctcgttcaacagtc
gggaccgtaaccgaaattaatgattatttaagactattatgggcgcgagttggtcaacca
atctgtcccaatgatggtacaccgattaccagtcagacggtcgaacagatggtgaatcga
gttttggatttgccggaacgttccaaggtgcaaatcatctcaccgatcgtccgtgctaaa
aaaggccaacataaaaaggtttttgaaaaaatcaaacgtgaaggctttgtgcgggtacga
gtagatgacgaaaccatggatgttgaagaagtaccagaattggataagaacaaagttcac
accattgatattgtggtcgaccgtgtggtggttaaagacggaattcggtctcgtttattt
gattcatttgaagcagctttacgcctcagtaagggttatgctacagcagatgtgattggt
ggcgaaccaatcttgttctcagaacattattcctgtccggtttgtgggttcacagtggga
gaacttgaaccccgactattttcatttaatgccccttttggagcatgtcctgaatgtgat
ggattaggaattaaattggaagtggatgaagatttagtcattccggatccatctaagacg
ttacgtgaaggagcaattgcaccttggaatccgattagttcgcaatattatccaacctta
ctagaacaagctgctaaaagttttggaattgatatggatactccttttgaggatttacct
aaagcagatcgccagctcgttttatatggttctaaaggtaagaaattccatttccactat
gaaaatgattttggtggagttcgggatgtggattccgtatttgaaggtgtaatggttaac
attgatcgtcgctatcatgaaactaatagtgatttcacgcgagatcaaatgcggttatat
atgcgcgaattaacgtgccaaacttgtcatggttaccgtttgaatcgaaaagctttatca
gtaaaaattgatggaaagcatattgccgaaatttcagctttacccatcgatagtgccatg
gaatttttcggtaatttaaacttttcggagcaggatacagctgttgccactccaatctta
aaagaaatcaaggaccgtttgaatttcttacgtaacgtgggattggagtatctaactttg
agtcgctcggctcgaacactttcaggtggggaagcccaacggattcgtttggcgactcaa
attggctcgaatttatctggtgtactatatattttggatgaaccttcaattggtttacat
caaagggataacaatcgattaattagttcccttaaaaagatgcgggatttaggtaacacg
ctagtagttgttgaacatgatgaagatacgatgtgggctgctgattatcttattgatatt
ggaccaggagctggtgaaaatggcggtgaagtcatggcagctggtactcctaagcaagtg
gctaaaagtcgtaaatcactgacgggtaagtatctatccggaaagaaatttattccagtt
ccagaaactaggcgtacgggtaatggtcaatctattaaattaaaaggggtacaagaaaat
aaccttaaaaatattgatgttgacttcccattaggtgaatttgtcgctgtaacgggagtt
tctggctcaggtaaatctacgttagtcaatatggttttaaaacgagttttggctcaaaaa
ttaaaccataattctgaaaaaccaggtaaatataaatcggttagtggtattaaaaatatt
gaaaaagttatcaatattgaccaatctccaattggccggaccccacgaagtaatccggca
acttatacgagcgttttcgatgatataagaggcttatttgctcagactaatgaagctaaa
ctccgaggatatacgaagggtcgttttagttttaacgtcaagggtggacgctgtgaagca
tgtaagggtgacggaattctaaaaattgagatgaatttcttgccagatgtttacgttcct
tgtgaggtctgtcatggaacacgttataactcagaaacacttgaagttaagtacaaaggc
aagacaattgctgatatcttggatatgacggtggaagaagcaacagatttctttgctccc
atccctaagattgctcgtaaacttcaaaccattattgatgtaggattgggctacgtacat
ttaggacaatcagctactaccctatctggtggtgaagcgcaacgtatgaagttagcttcc
gaactacacaaaaaagcgaatggtaagaacttctatatcctagatgaaccaactactggt
ttgcatacagacgacatcaaacgtttgttagatgtattacaacgtttggtagataatggt
aatactgttttagtaatcgaacataatttagatgtaattaaaactgccgatcacttgatt
gatctgggtcctgaagggggcgctggtggtggacaagtggtggctgttggtacaccggaa
gccattgctgcggtacctgaaagctatactggtaaatatttgaaagaagttctggagcgt
gctcaagaacttagtcagaaataa

DBGET integrated database retrieval system