KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0672
Entry
PEPE_0672         CDS       T00409                                 

Definition
(GenBank) Membrane carboxypeptidase (penicillin-binding protein)
  KO
K12555  penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00550  Peptidoglycan biosynthesis
ppe01100  Metabolic pathways
ppe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PEPE_0672
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PEPE_0672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppe01003]
    PEPE_0672
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppe01011]
    PEPE_0672
Enzymes [BR:ppe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PEPE_0672
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PEPE_0672
Glycosyltransferases [BR:ppe01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   PEPE_0672
Peptidoglycan biosynthesis and degradation proteins [BR:ppe01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PEPE_0672
SSDB
Motif
Pfam: Transgly Transpeptidase PHBC_N
Other DBs
NCBI-ProteinID: ABJ67733
UniProt: Q03GD9
LinkDB
Position
710987..713140
AA seq 717 aa
MNMKKIGSAIKAFLQKIGAFLKPVWDKIHPFIHKYWHRYQLTRWIIVVVLAVVFFSSAIL
TYQAKTANVKNLKAALSQPTLVYDKNNAKAGSLYSQKGTWTNLDNISPNVQNAVIATEDR
NFYKEYGFSIKGIGRAFVMYGVNKLLGRDYISGGGSTLTQQLVKNAFLSQQQTFTRKAKE
LFLSIEVENVYSKKDILAMYLNNAYFGNGVWGVQDAAERYFGVSASELSVPQAATLAGML
TNPSGYNPIDHPKNAFSRRNVVLSLMAETGKISKADAKSYAQTAISTSDNYNSEDGYKYP
YYFDAVIDEAISEYGLTESDIMNRGYKIYTYLDQDSQQGMQDTFDNSANFPVDATDGTKV
QAASVAVNAKNGGVEAVVGGRGNHVFRGYNRATQIKRQPGSTLKPIAVYAPALASGYSYS
SMLEDKLQTYGTNKYKPENYNNEYAGKIAMYQALEQSKNAPAVWLLNKIGVDKGYDYTKK
FGLNPSKDDKNLAMALGGLTNGVSPIQLASAYTAFANNGTLSKTGFIRKIVDASGNTIVN
NTTESKRVISKKVAKEMTSMMLGVYGDSSGTGYGAEPFGYTIAGKTGSTEADTGTSPSDA
TRDKWMVGYTKDVVVATWEGFDDTNKTHHLENITGVGMNSMFKSEMSAILPNTKGTSFDV
KSASTLANSGNNVTSNVWDNIEDGTSSITDSISRGASGVKEKAGEFFNEAKKFITGN
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgaatatgaaaaaaatagggagtgcgattaaagcattcttacaaaagattggtgcattt
ttaaaacccgtgtgggataaaattcacccgttcatccataagtactggcacagatatcag
cttacgcgatggattattgtagtagttttagcagttgtatttttctcaagtgcgatttta
acttatcaagcgaagactgctaatgtaaaaaatttaaaagcagctttatcccagcctact
ttagtttatgataaaaataatgctaaagctggaagtttatattctcaaaaaggaacctgg
acaaatctagataatatctcacctaacgttcaaaatgccgtaattgcgacggaagaccga
aacttttataaggaatatggtttttcaattaagggaatcggtagagcgtttgtgatgtac
ggggtcaataaattacttggtcgagattatatatctggtgggggaagtactttaacccaa
caattagtaaaaaatgcctttctatcacagcaacagacctttactagaaaggctaaagag
ttatttttatcaattgaagttgaaaatgtttattcaaaaaaagatatcttagcaatgtac
ttgaataacgcctattttggaaatggggtttggggagtacaggatgctgctgagaggtat
ttcggggtcagtgcttcggaactatcggttccccaagcggcaaccttggcagggatgctg
actaatccgagtggctataatccgatcgatcatccaaaaaatgccttttcacgccgtaat
gtagttttaagtttgatggcggaaaccggtaagatatccaaggccgacgccaaatcctat
gctcaaacagctatctcaaccagtgataattacaatagtgaggacggttataagtatcca
tactactttgatgcagtaatcgatgaagccattagcgagtatggattgacggagtcggat
attatgaatcgcgggtataaaatttatacgtatctggatcaggatagtcagcaaggtatg
caagatacttttgacaactccgctaattttccggttgatgctacagatggtactaaagta
caggctgcatctgttgcagtaaatgccaaaaatggtggtgtagaagcggtagttggtggt
cgtggtaatcatgtctttagaggctataaccgagctacccagattaaacgccaacctggc
tcaaccttaaaacctattgcagtttacgccccagctttagcgagtggatatagttatagt
tctatgttagaagataaacttcaaacatatggaactaataaatataaacctgaaaattac
aataacgaatatgcaggaaagattgcgatgtaccaagcacttgaacaaagtaaaaatgcg
cctgcggtatggttattaaataaaattggtgtagataagggttacgattacaccaagaaa
ttcggcttaaacccaagcaaagatgataagaacctagcgatggctcttggtggattgacg
aatggtgtatcgccaattcaactagcttctgcttatactgcatttgctaataatggaacg
ttgtcgaagactggatttattcgcaaaattgtagatgcttctggaaatacgatcgtaaat
aacaccacggaatccaaacgagttatttcaaaaaaggtcgctaaagaaatgaccagtatg
atgttaggtgtttatggtgacagttctggcacaggttatggggcagaaccttttggttat
acaattgctggtaaaacaggtagtactgaagcagatacaggaactagtccatcagatgca
acccgtgacaaatggatggtaggatatacaaaggatgttgtagttgctacttgggaaggg
tttgatgacacaaacaagacccatcatctggaaaatattacgggagtcggcatgaatagt
atgttcaagagtgaaatgagtgccattttaccaaatacgaaaggtacttcatttgacgtt
aaatcagcttctactctagctaatagtggaaacaatgttacatcaaacgtttgggacaat
attgaagacggaacttcttccatcacagatagtatttctcgaggagctagtggggtcaaa
gagaaagcgggagaattcttcaacgaagctaaaaagttcattaccgggaattga

DBGET integrated database retrieval system