KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1135
Entry
PEPE_1135         CDS       T00409                                 

Definition
(GenBank) Excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_1135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_1135
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PEPE_1135
SSDB
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH_5 HHH_2 5_3_exonuc
Other DBs
NCBI-ProteinID: ABJ68189
UniProt: Q03F33
LinkDB
Position
complement(1134348..1136132)
AA seq 594 aa
MASEHIEHKLALLPDKPGCYQMKNLNSQIIYVGKAKNLKNRVRSYFKSSHEGKTAKLVSE
IADFDYIVTSSDKEAFLLEITLIQKFQPYYNIKLKKGTGYPYIKITNEKDPRMEIVSSVR
RDGGFYFGPYPNVYAAEETLHFLEKVYPLRRCNGFQGRPCLYYHMGQCLGACFQEVPKEE
YDQQIAKIKSFLRGNVAKIKQSLQTKMQKASEAMEFERAADIRDQIHYIEVTVEKQKIIS
NDSTPRDLFNFYLDKGWLSIQIFFIRQSRLIKREKRLFPIATDVNDELSSFILQFYNNKN
KVLPNEILVPSGLDNKIMAEILGVPVRTPQRGEKKNLLELAKENAQITLEEKFRLMELDE
SKTTGAMKEITDALGIPEGHRIEAFDHSHIQGSELVSAMVVFTDGKPDKKMYRKFKLNTV
DHADEAASTREVIRRRYVRLLKEKQSLPDLILMDGGDIQLNAAKDVLVNELSLHIPVAGM
VKNDKHKTSDLIFGSQDQRVQLDPKSQGFYLVQRIQDEVHRFAITFHRQLHAKNSLASQL
DLIQGVGPKTRNKLLKSFGSLNKIRDANLKEIEELGIPEKVAKTIKVSLSVHGK
NT seq 1785 nt   +upstreamnt  +downstreamnt
ttggcatcagaacacattgaacataagttggcattgttaccagataaaccaggctgttac
cagatgaaaaatcttaatagccaaatcatttacgttggaaaagccaaaaacttgaaaaac
cgtgttcgctcttactttaaaagtagccatgagggaaaaacggcgaaactagtgagtgaa
atagccgattttgactatattgttacctctagcgataaagaagcttttttactagaaatt
actttaattcaaaagttccaaccttattacaatataaaattgaaaaaagggactggctat
ccttatattaaaattacgaatgaaaaagatccacgaatggaaattgtttcaagtgttcgt
cgagatgggggcttttactttggaccttatccaaacgtgtatgctgctgaagaaacactc
cattttttggaaaaggtttatccactacgccgatgcaatggatttcagggtcgcccctgc
ttgtactatcatatggggcaatgcttgggagcctgtttccaagaggtacccaaagaagaa
tacgaccaacaaatcgctaaaattaaatcatttttacgaggaaatgtcgcaaagattaag
cagtcccttcaaacaaaaatgcaaaaagcttctgaagcaatggaatttgaacgggcagcc
gacatacgagatcaaattcattatattgaagtaacggttgagaagcagaagattatttca
aatgatagcacgccacgtgatttgtttaatttctaccttgataaggggtggctttctatt
caaatcttctttatccggcaatcacgcttgattaaacgagagaagaggctatttccaatc
gcaacagatgtaaatgatgagctttcgtcttttattcttcaattttataataataaaaat
aaggttttaccaaatgaaattttagtaccaagtggcttagataataagattatggccgaa
attttaggtgtcccggttcgcactccacagcgtggggaaaagaaaaacttgttagagtta
gctaaagaaaatgcacaaattacccttgaggaaaagttccgattaatggagttagatgaa
agtaaaacaacaggcgcaatgaaggaaattactgatgcgcttggaatccctgaaggtcat
cgaattgaagcctttgaccattctcatattcaaggctctgaattagtttcagcaatggtt
gtttttacggatggaaaaccagataaaaagatgtatcgcaaatttaagctaaatacagtc
gatcatgctgatgaagctgccagtacgagagaggtaattcgtcgccgatatgttagacta
ttaaaagagaaacaatctttgcctgatttgattttaatggacggtggcgatattcagctt
aatgcagcaaaggatgttttggtaaatgaattaagtttgcatattccagttgctgggatg
gttaaaaatgataaacataaaacttcggatttgatttttggtagccaagaccaacgagta
cagttggatcctaaaagtcagggcttttatttagttcaaagaatccaagatgaagtgcat
cgttttgcgattactttccatcgtcagttgcacgccaaaaattcgttggcttcccaatta
gatttaattcaaggtgttggacctaaaacgcggaacaagctgttgaagtcgtttggttca
ttgaataaaattagggatgctaatttgaaagaaattgaagaactcggaattccagaaaaa
gtagctaaaactatcaaagtgtccttatcagtgcacggaaaatag

DBGET integrated database retrieval system