KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1143Help
Entry
PEPE_1143         CDS       T00409                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Brite
Translation factors [BR:ppe03012]
 Eukaryotic Type
  Elongation factors
   PEPE_1143
 Prokaryotic Type
   PEPE_1143
Mitochondrial biogenesis [BR:ppe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PEPE_1143
Exosome [BR:ppe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PEPE_1143
  Exosomal proteins of breast cancer cells
   PEPE_1143
  Exosomal proteins of colorectal cancer cells
   PEPE_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ABJ68197
UniProt: Q03F25
LinkDB All DBs
Position
complement(1142645..1143832)
Genome map
AA seq 395 aa AA seqDB search
MAKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLSEKGLAKASDYADIDAAPEEKERG
ITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLAHQVGVDYIVVFLNKTDLVDDDELVDLVEMEVRELLSEYDFPGDDVPVLRGSALKALE
GDAEQEKVIMDLMDTIDEYIPTPERSTDKPFLMPVEDVFTITGRGTVASGRIDRGEIKVG
DEVEIVGLKEDVTKTTVTGIEMFRKTLDVGEAGDNIGALLRGVNREDVVRGQVLAAPGSI
QTHKKFKGEVYILSKDEGGRHTPFFSNYRPQFYFHTTDVTGVIELPDNVEMVMPGDNVTF
TVELIEPVAIEKGTKFTVREGGHTVGAGVVSEIDD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaacattacgaaagaacaaaaccccatgtaaatattggtacaattggccac
gttgaccatgggaaaactactttgacagctgctattacaaaagtgttgtcagaaaaagga
ctagctaaagcttcagattacgctgatattgatgctgctccagaagaaaaggaacgtggt
atcacaatcaacacagcccacgttgaatatgaaacagaaaagcgtcattacgctcatatc
gatgctccaggacatgctgattacgttaagaacatgatcactggtgctgcacaaatggat
ggtgctatcttagttgttgctgcaactgatggtcctatgccacaaacacgtgaacatatc
cttcttgctcaccaagttggtgttgactacatcgttgtcttcttaaacaagactgatctt
gttgatgatgatgaattagttgaccttgttgagatggaagttcgtgaacttctatctgaa
tatgatttccctggtgacgatgttcctgtacttcgcggttcagctttgaaagctcttgaa
ggcgatgcagaacaagaaaaagttatcatggatcttatggatacaatcgacgaatacatt
ccaacaccagaacgttctacagacaagccattcttgatgcctgttgaagacgtatttaca
attactggtcgtggtactgttgcttctggtcgtatcgatcgtggtgaaatcaaagtcggt
gacgaagttgaaatcgttggtcttaaagaagacgtaacaaagacaactgttacaggaatt
gaaatgttccgtaagactcttgatgttggtgaagctggtgataacattggtgcacttcta
cgtggtgttaaccgtgaagatgttgtccgtggacaagttttggctgctcctggctcaatc
caaacacacaagaagttcaagggtgaagtttatatcctttctaaggatgaaggtggacgt
catactccattcttctcaaactaccgtcctcaattctacttccatacaactgatgtaaca
ggtgttattgaattacctgacaacgttgaaatggttatgcctggtgataacgttacattt
actgtagaacttatcgaaccagttgctattgaaaaaggtactaagttcactgttcgtgaa
ggtggacacactgttggtgctggtgttgtatcagaaattgacgactaa

DBGET integrated database retrieval system