KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1157Help
Entry
PEPE_1157         CDS       T00409                                 

Definition
(GenBank) Archaeal fructose-1,6-bisphosphatase related enzyme of inositol monophosphatase family
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00521  Streptomycin biosynthesis
ppe00562  Inositol phosphate metabolism
ppe01100  Metabolic pathways
ppe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PEPE_1157
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PEPE_1157
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     PEPE_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P Ret2_MD
Motif
Other DBs
NCBI-ProteinID: ABJ68211
UniProt: Q03F11
LinkDB All DBs
Position
complement(1156541..1157326)
Genome map
AA seq 261 aa AA seqDB search
MKNIDKDFLLQLDAKIVEFLVKDRQFIFEKMGKHLEVDEKQNRRDLVTEVDRGNQAHIIE
ALSQLLPDAKILAEESENDLTDAKGLMWVIDPIDGTMNFVKQREDFAVMIALYEDGKPLL
GYIYDVMRDVLLHGGPGIGVVYKNQDVINPPANLALEESLIGLSGPMLVNNAYHFQDVEK
RTLGARVIGSAGIEFIRVLLGKQIGYVSSLKPWDFAAGNALAAVFGLKVGYVDGEAINVL
KSGVVLVATKKAYSAIMSIVK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagataaagatttcttacttcaattagacgccaaaatagtggaatttcta
gtcaaagatcgtcaatttatttttgaaaagatgggaaagcatttggaagttgatgaaaaa
caaaaccgccgagatttggtaactgaagtggatcgtggtaatcaagctcacattattgaa
gcgttaagtcaattactccctgatgctaaaattttagctgaggaatctgaaaatgattta
actgatgccaaggggttgatgtgggtcattgatccaattgatgggaccatgaattttgtt
aagcaacgtgaagattttgctgtaatgatcgctctatatgaagatggaaaacctttgttg
ggatatatttacgatgtcatgcgcgatgttttattacatggcggaccgggaattggagtg
gtatataaaaatcaagatgtaatcaatcctccagccaatctagctctagaagaaagttta
atcgggttaagtggcccaatgctagttaataatgcatatcacttccaagacgttgaaaaa
agaacgctaggagctagagttattggcagtgcaggaatcgaatttattcgagtacttttg
ggtaaacaaattggatatgtttctagcttaaaaccatgggattttgctgctggaaacgct
ttagcggcggtctttgggttaaaagtagggtatgttgacggagaggctattaatgtgcta
aaatcgggcgttgtactagttgctacgaaaaaagcatattctgctataatgagtatagtg
aaatag

DBGET integrated database retrieval system