KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1249Help
Entry
PEPE_1249         CDS       T00409                                 

Definition
(GenBank) Glycerol uptake facilitator related permease
  KO
K02440  glycerol uptake facilitator protein
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppe02000]
    PEPE_1249
Transporters [BR:ppe02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    PEPE_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP PelG
Motif
Other DBs
NCBI-ProteinID: ABJ68290
UniProt: Q03ET2
LinkDB All DBs
Position
1235293..1236024
Genome map
AA seq 243 aa AA seqDB search
MEYSFFAKLAAEFLGTAILVLLGNGSVANVELKGTKGNGSDWLVIAVGYGCGVMVPALMF
GTISGAQINPAFTIGLAVSGMFSWSQVLPFIIAQMLGAIFGQLVVYFAYKPHYDLTTNTE
SILGTFSTIDASHSSWNGFANEFIGSFVLFFGATAFTHAPYFEANKGSVFIALGFLVGTL
VASLGGATGPALNPARDLGPRLVHAMLPIKHKGSSQWGYASVPVVAPILAGICAVALYKG
LFL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaatatagtttttttgccaagttagcagctgaatttcttggtacagcaattttagtt
cttttaggtaatggttcggttgctaacgttgagcttaaaggtacaaaaggtaacggtagt
gattggttagtcatcgcagttgggtacggatgtggtgtaatggtccctgcattaatgttt
ggaactatttctggagctcaaattaatcctgctttcaccattggtttagcagtttcagga
atgttctcatggtctcaggtccttcctttcattattgcccaaatgttaggtgctattttc
ggacaattagtagtttattttgcttacaagcctcattatgatttaactactaatactgaa
tcaattttaggtacgtttagtacaattgatgctagtcatagctcttggaatggttttgct
aacgaatttattggttcattcgtcctcttctttggggctacagcctttactcatgctcct
tatttcgaggctaataaaggatcagtatttattgcacttggttttctagttggtactttg
gttgcttcacttggtggtgctactggtccagctttgaatcctgctcgtgacttaggtccc
cgtttagttcacgcaatgctcccaatcaaacataaaggatcatctcaatggggttacgca
tcagttcccgttgttgccccaatcttagctggtatttgtgccgttgctttgtataaagga
cttttcctataa

DBGET integrated database retrieval system