KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1294
Entry
PEPE_1294         CDS       T00409                                 

Definition
(GenBank) Cysteine sulfinate desulfinase/cysteine desulfurase related enzyme
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00730  Thiamine metabolism
ppe01100  Metabolic pathways
ppe01240  Biosynthesis of cofactors
ppe04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PEPE_1294
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    PEPE_1294
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppe03016]
    PEPE_1294
   03029 Mitochondrial biogenesis [BR:ppe03029]
    PEPE_1294
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ppe02048]
    PEPE_1294
Enzymes [BR:ppe01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     PEPE_1294
Transfer RNA biogenesis [BR:ppe03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    PEPE_1294
 Prokaryotic type
    PEPE_1294
Mitochondrial biogenesis [BR:ppe03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    PEPE_1294
Prokaryotic defense system [BR:ppe02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   PEPE_1294
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: ABJ68335
UniProt: Q03EN7
LinkDB
Position
complement(1286173..1287327)
AA seq 384 aa
MIYFDNSATTKVDKNVLETYQKVSNKIWGNPSSLHDMGEMSFNLLEQSRKQIASLLNVKP
HEIFFTSGGTEGDNWVIKGTAMEKRMYGKHLITTAVEHPAVKNSMEQLAQLGFDITYLPV
DDEGRINIQDLKDAIRPDTILVSIMAINNEIGTIQPLLKAAEVLKDYPKVHFHIDAVQGI
GKGIQAAIMNDRVDFVTFSGHKFHAPRGVGFIYAREGRRIAPLLTGGGQEKNLRSGTENL
PAIAGMAKALRLLLDGEDQKVALQESIKEKIYNHVTKFEKVVAFSKIQANFAPHILCFAI
KGVRGETIVHAFESHGIYISTTSACSSKKQQASSTLTAMKIDSTISTSAVRVSLDSANSL
EEADEFNRIFDQLYQDFSKINKNS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgatttattttgataatagtgcaacaactaaagttgataagaacgttttagagacctac
caaaaggtcagtaataagatttggggtaacccttctagtttgcatgatatgggcgaaatg
tcgttcaatttattggagcagtctagaaaacaaattgctagtttgttaaatgttaaacct
cacgaaatattttttacaagtggtggaacggaaggcgacaactgggtaattaaagggaca
gcgatggaaaaacggatgtatggaaagcatctaattacgacggctgtcgaacatcctgcc
gtaaaaaattctatggaacagttagcacaattaggatttgatattacctatcttcccgtt
gatgatgagggtcgaattaacattcaagatttaaaagatgccattcgcccggatacgatt
ctggtttcgattatggcaattaataatgaaattggaacaattcaaccacttttaaaagca
gcagaagttttaaaggactatccaaaagtacattttcatatcgatgctgttcaaggaatt
ggtaaagggattcaagctgcaatcatgaatgatcgtgttgattttgtaaccttctctggc
cataaatttcatgctcctcgaggggtgggttttatttatgcgcgcgaaggtaggcgaatt
gcaccattgttaactggtggtggacaggaaaagaatttacggagtggaacggagaactta
cctgcgattgctgggatggctaaggcactgcgtttactacttgatggcgaagatcaaaag
gtagctttacaagaatcaattaaagagaaaatttataatcacgtaactaagtttgaaaaa
gtggttgctttttctaaaattcaagctaactttgctccgcatattttgtgttttgcaatt
aaaggggtgcgtggagaaacgattgttcatgcgtttgaatcacatggaatttacatttcg
accactagtgcttgttcttctaaaaaacagcaagcttcaagtactttaacggcaatgaag
attgactcaaccatttcaacgagtgccgtccgagttagcttagatagtgctaattctttg
gaagaagctgatgaatttaatcgaatttttgaccaattatatcaagacttttcaaaaata
aataaaaatagctag

DBGET integrated database retrieval system