KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1372
Entry
PEPE_1372         CDS       T00409                                 

Definition
(GenBank) ATP-dependent DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
ppe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_1372
   03430 Mismatch repair
    PEPE_1372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_1372
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PEPE_1372
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PEPE_1372
   MMR (mismatch excision repair)
    Other MMR factors
     PEPE_1372
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 Exonuc_V_gamma ChuX_HutX ResIII AAA_16 DEAD DUF3553 DXPR_C
Other DBs
NCBI-ProteinID: ABJ68410
UniProt: Q03EG2
LinkDB
Position
complement(1360035..1362308)
AA seq 757 aa
MPEINLIKGLNDMQKEAVQTTEGPLLIMAGAGSGKTRVLTHRVAYLIEEKGVNPWNVLAI
TFTNKAAREMRERVTSLLGDEAAEIWVSTFHALCVRILRRNIDQLGYNRAFSIADPSEQR
TLVKHILADLNYDPKKFDPRSVLGTISNAKNDLKTPLTYRENASTPYEQVVADIYEEYQR
RLENNQALDFDDLIMKTIELFQKNPETLSFYQNKFHYIHVDEYQDTNQAQYQLVTMLAKH
FRNICVVGDSDQSIYGWRGADMQNIMNFESDYPDSKTVMLEQNYRSTQNILNAANDVIEN
NVERKPKQLWTDNDEGEKISYYRGQTGIDEAHFIVQKIREQIKEHNLNYGDFAILYRTNA
QSRVIEDTFVKSNIPYLMVGGHKFYDRKEIRDVLSYLTLIANEDDSMSFERVINEPKRGI
GSTSIAKLQAFADENNWSLLKAARSVQIANGISSRARNAIEDFAKMIDALRKSGEFLNIT
ELTEAVLEQTGYRAALEKSRTMESEARLENIDEFLTVTKQFDDKNEAEGNEIADENGDNI
QLVDFLADLALVSDQDNVEEEPSGVTLMTLHAAKGLEFPIVFLVGMEDGIFPLSRAMMDQ
EQLEEERRLAYVGITRARQKLYITNAYSRMLYGRTQTNPASRFISEIGSQYLKSENEEKS
FSRNTKEKSYPFDNNRNARATASVYGNTHATAVKSNGSGAGKVSWNAGDKVEHKAWGIGT
VVKVSGAGEDAELDIAFKDQGIKRLLAAFAPIKRVVE
NT seq 2274 nt   +upstreamnt  +downstreamnt
ttgccagaaattaatttaataaaaggccttaatgatatgcaaaaagaagcggttcagaca
actgaaggaccgttattgattatggccggcgccggtagtggtaagacccgagttttgacg
caccgcgttgcatatctaatagaagaaaaaggtgttaatccgtggaatgttttggcaatt
accttcactaataaggctgctagagagatgcgtgagcgagttactagtttgctgggtgat
gaagctgctgaaatttgggtatcaacgttccatgctctttgcgtaagaattttaagaaga
aatattgatcaacttggatataatcgagcattttcgattgccgatcctagcgaacaaaga
accctagttaaacatattttagccgatttaaattatgatcctaaaaagtttgatccacgt
tcagttttaggaacgatttccaatgctaaaaatgatttaaaaacgccactcacttatcgt
gagaatgcaagtactccatatgaacaggtagtcgcagatatctatgaagaatatcagcgt
cgcttagagaacaatcaggctttagattttgatgatttgattatgaaaaccatcgaactt
ttccaaaagaatcctgaaaccttatcattttatcaaaataaatttcattatattcatgtg
gatgaatatcaggatactaatcaggctcaatatcaattagtaacgatgctagctaaacat
tttagaaatatctgtgtagttggtgattctgatcaaagtatttatggttggcggggcgcc
gatatgcaaaacatcatgaactttgaatcagattatccagattcaaagactgtaatgttg
gaacaaaactatcgttcaacccaaaatattttaaatgctgctaatgatgtgattgaaaat
aatgtagaacgtaaacctaaacaactttggactgataatgatgaaggtgaaaaaatttca
tattatcgtggccagacggggattgatgaagcccatttcatcgttcaaaaaattcgtgag
caaattaaagagcataatttaaattacggagattttgccattctttaccggacgaatgca
cagtcacgagtaattgaagatacgtttgttaaatccaacatcccttacttaatggtcggg
ggacataaattctacgatcgtaaggaaattagagatgtactgagttaccttactttgatt
gctaacgaagacgattcgatgagttttgaacgagtgatcaatgaacctaaacgtgggatt
ggttcgacttctattgctaaattacaagctttcgcggatgaaaataattggtccttattg
aaagcggctcgtagtgttcagattgcaaatggaatttctagtcgagctcgcaatgcaatt
gaagatttcgctaagatgattgacgctctacgtaaatcaggtgaatttttaaatatcaca
gaattaacagaagcagtcttggaacaaactggttatcgagctgctttagaaaaatctaga
acgatggaatcagaagcacgccttgaaaatattgacgaatttttaacagttactaagcaa
tttgacgataagaatgaagctgagggaaatgaaattgctgacgaaaatggtgataacatt
caattagtagatttcctagcggatttggccttagtttctgatcaagataatgtggaagaa
gaaccatcaggagtaaccctcatgaccctgcatgcggctaagggtcttgaatttccaatc
gtatttttagttgggatggaagatggaattttcccactttctagagcaatgatggaccaa
gaacaattggaagaagaacgacgattagcctatgttggaatcacccgagcacgtcaaaag
ttgtatattacgaatgcttattctagaatgctttatggtaggacacaaactaatccagct
tcacggttcatttcagaaattggatcacaatatttgaagagtgaaaatgaagaaaagagt
ttttcaagaaatactaaagaaaaatcatatccgtttgacaataaccgaaatgcacgcgca
acagctagtgtttatggtaatacccatgctacggcggttaaatctaatggtagcggagct
ggtaaagttagctggaatgctggggataaagtcgaacataaagcttggggtattggtacc
gtagtgaaggtgtctggcgctggagaagatgccgaattggatatcgcctttaaagatcaa
ggaattaagcggttattggccgcttttgcaccaattaaacgggttgttgaataa

DBGET integrated database retrieval system