KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1552
Entry
PEPE_1552         CDS       T00409                                 

Definition
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PEPE_1552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppe03400]
    PEPE_1552
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PEPE_1552
DNA repair and recombination proteins [BR:ppe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      PEPE_1552
SSDB
Motif
Pfam: CarD_CdnL_TRCF UvrB_inter TRCF Helicase_C DEAD ResIII UB2H Mg296 AAA_22 DUF4363 CdvA Val_tRNA-synt_C
Other DBs
NCBI-ProteinID: ABJ68573
UniProt: Q03DZ9
LinkDB
Position
complement(1519047..1522544)
AA seq 1165 aa
MNINEIFASDSGVTTVVDALQKGSRQLVTGLLEPAKQLFLSTIIETKSAPILYVTDSLAR
AEHVYNMFKEEQSEIDTYWFPAEEIIAAEVATSSPNYRTARIQFLSALATSKTGIFITST
SGLRRLVPEPKDVIEARITLEVGAEYEFQTLISDLNALGYQRVEQVEKKGEFAVRGSVVD
IFPLNQDDPIRMDFFDIEIDSLRTFDQATQRSIENIEKIEVLPATDLIINETKLNQAIKT
MNNELAQAQKKLSEENFEALQQNINEVIERWKHHQLIQEDTMYAKQLYAAKTSLLDYLTK
GTLVLDDYPRILDAETDIENNEASWIVDQLKNNVLLDNESFGVDIRTLIKKKSVPQLFLS
MFQKGMGRLKFDQLTEITTRAVQDFFGQMPVLKGEVERWLARKQTVLIFANSKERQGKIT
EVLHDFEITAQKVNADRIQVAAVNIIGQSFPQGFDMPSTKLVVLTEKELFAKVPKKRPRQ
QHVENAERLKSYTELKTGDYVVHVNHGIGKFMGMTTMEVDGVHQDYMTIQYKGSGQLFIP
VTQLNLVQKYVAAEGKSPKLNKLGGSDWAKTKKNVASKIEDIADDLIELYAKREAEKGFA
FKPDDSYQRQFDNDFPYTETPDQLRSIEEIKKDMERERPMDRLLVGDVGYGKTEVALRAA
FKAVESGKQVAILVPTTILAQQHFDTMNERFEGYPIATGILSRFQTGAQVKETLEGLKDG
SVDVIVGTHRLLSKDVEFKDLGLLVIDEEQRFGVKHKERIKELKSQVDVLTLTATPIPRT
LNMSMIGVRDLSVIETPPTNRYPIQTYVMEENAGAIREGIMREMRRNGQVFYLHNRVQDI
EKVVAEIEALVPEARVGYIHGQMTEKQLEDILFEFIAGEYDVLVTTTIIETGIDIPNANT
LFVENADHMGLSQLYQLRGRIGRSSRVAYAYFLYQKNRVLTELGEKRLEAIKDFTELGSG
FKIAMRDLSIRGAGNLLGKQQHGFIDSVGYDLYSQMLADAVKKKQGKKVKRRSDSEISLG
IEGFLPSSYIEDEQQKIEFYKRLRQANSHEEVVDIQDDMLDRFGDYPAEVDNLLQITDLK
IIADQVQVERITRKDGILTVTMTRAASQKLTGEQIFEALSVTRLRATVAESDAKMHIKLV
IQPRMTQKDWFTQLFNYIEKLKEYV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgaatataaatgaaatttttgcatctgattcgggagttacaaccgttgttgatgctctc
caaaaagggtcgcggcaattagttactggtttactagagccggctaaacaacttttctta
agtacgattattgaaactaaatcagccccaattttatatgtaacagatagcttagcgcgg
gccgaacatgtctataacatgtttaaagaagaacagtccgagattgatacgtattggttt
ccagctgaagagattattgcggccgaggtggccactagttcgccaaattatcgtacggca
cgaatccaatttttaagtgctttagcgacatcaaagacaggtatttttattacttctaca
tccggtttacgccgattagttcccgaacctaaggatgttattgaagctcgaatcactctg
gaagtgggagctgaatatgagtttcaaactttaattagcgatctgaatgcgctgggatac
caacgggttgaacaggtggaaaagaaaggtgaatttgcggttcgaggttcggtagttgat
atttttccacttaatcaagatgacccaatccgaatggatttttttgatatcgaaatcgat
tcgctgcgaacttttgatcaagcaacccagcgaagtattgaaaatatcgaaaaaattgaa
gtattgcccgctacagacttgataataaatgaaacaaaattaaaccaagcaattaaaacg
atgaataacgagctggcgcaagctcaaaaaaaattaagtgaagaaaactttgaggcttta
caacaaaatattaatgaagtaatcgagcgctggaaacaccaccaactgattcaagaagat
acaatgtacgctaaacaattgtatgcagctaaaacttcattgctagattatctaacaaag
ggcacgctagttttagacgactatccccggatcttggatgctgaaactgacattgaaaat
aatgaagccagttggatcgttgatcagttaaaaaataacgtgttgttagataacgaatcc
tttggcgtcgatattcgaacattgatcaagaaaaagtctgttcctcagttatttttgtcg
atgttccaaaaagggatggggcgcttaaagtttgaccagttgacggaaatcactactagg
gctgtccaagatttctttggacaaatgcctgttttaaaaggtgaggtggaacgatggtta
gctcgtaagcaaacggtgttaatctttgccaattccaaagaacgacaaggaaaaattacc
gaagtgcttcacgattttgagattactgctcaaaaagttaatgctgatcgaattcaagtg
gcagcggttaacattattggacaatcatttccacaaggttttgatatgcctagtacgaaa
ttggtagtgttaacggagaaagagctatttgctaaggttcctaaaaaacgtcctcgccaa
caacatgtggaaaatgccgaacgtctcaaaagttatacagaactaaaaactggggactac
gttgttcatgtcaatcacgggattggaaagtttatgggaatgaccacgatggaagtcgat
ggcgttcatcaagattatatgaccatccagtacaaagggagtggtcaattatttattccg
gtaacacagttaaatcttgtacaaaaatacgttgcagcggaaggtaaaagccctaaacta
aataaactgggtggctctgactgggctaagacgaagaagaacgttgcttctaagattgaa
gacattgccgatgacttaattgaactgtatgccaaaagggaagctgaaaaagggtttgct
tttaaaccagatgacagctatcaacgtcaatttgataatgattttccatatactgaaact
ccagatcaattacggtccattgaagaaatcaagaaagatatggaaagagaacgcccgatg
gatcgtttgctagtaggagatgttggctacggtaaaacagaagttgcgttacgggccgcc
tttaaagcggttgaaagtggtaaacaagtggctattttagttcccaccactattctggcg
caacagcattttgatacgatgaatgaacggtttgaaggatacccaattgcaacgggaata
ttgtctcgtttccaaactggggcacaagttaaggagacccttgagggattaaaagatggc
agtgtagacgtgattgttggaacccatcgactattatctaaggatgttgaatttaaagat
ttaggattactggtaattgatgaggaacaacgttttggggttaaacataaggaacgaatt
aaagagcttaaatcacaggtggatgttttaaccttgaccgcgacccccattcctcggaca
ttgaacatgtccatgattggggtgcgagatttgtcagtgattgaaacaccgccaactaat
cgttatccgattcaaacgtatgtaatggaagaaaacgcgggggctattcgtgaaggaatt
atgcgagaaatgcgccgtaatggacaggttttctaccttcataatcgagttcaagatatt
gaaaaagtagtggctgaaattgaagcattagttccagaagcccgagtgggttatattcat
ggacaaatgaccgagaaacaattagaagatatcttgtttgaatttattgcgggtgagtac
gatgtgttagttacaacgacaatcattgaaaccggaattgatattccgaatgctaacact
ctttttgtggaaaatgccgatcatatgggactttcccaattatatcaacttcgtggtcga
attgggcgttcatcacgggtggcttacgcgtatttcttgtatcagaaaaaccgagtgtta
actgaattaggcgaaaaacgattggaagccatcaaagatttcacagaactaggttctgga
tttaaaattgctatgcgagatttatcaattcgaggcgcgggaaatctgttaggaaaacaa
caacatggctttatcgattctgttggatatgatttatactcacaaatgctggcagatgcg
gttaagaagaagcaaggtaaaaaggttaaacggcgttcagatagtgagattagtctcgga
atcgaaggttttcttcctagttcttatattgaagatgaacagcagaaaatcgaattctat
aaacgattacgtcaggctaacagtcatgaagaagttgttgatattcaagatgatatgtta
gaccgctttggagattatccagctgaagttgataatttattacaaattaccgacttgaaa
attatagccgatcaagttcaagtcgaaagaatcacccgcaaggacggtattttaactgta
actatgacaagggcagccagccaaaaattaactggtgagcagatatttgaagcattatca
gttacaagactgagagcgacggtagcggaatcagatgctaaaatgcatattaagctggta
attcaaccacgaatgacacaaaaggattggtttacacagctgtttaattatattgagaaa
cttaaagaatatgtgtga

DBGET integrated database retrieval system