KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1562
Entry
PEPE_1562         CDS       T00409                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00300  Lysine biosynthesis
ppe00550  Peptidoglycan biosynthesis
ppe01100  Metabolic pathways
ppe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PEPE_1562
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PEPE_1562
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PEPE_1562
Enzymes [BR:ppe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     PEPE_1562
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF2536 DUF1727
Other DBs
NCBI-ProteinID: ABJ68583
UniProt: Q03DY9
LinkDB
Position
complement(1531083..1532465)
AA seq 460 aa
MKMQLSEIARALGTDEYPELWNDISVTSVQFDSRKLSPGSLFVPIMGERDGHDFISQAVT
AGAVATLWAEDHQERRPADLPSILVKNPLEALQKLAKYYLDKINPKVVAITGSNGKTTTK
DMTAAVLEAEYNVVKTKANFNNELGVPITILGMSSNTEVLVVEMGMDRPGQLHFLSELVQ
PDIAVITMIGEAHIEFFKTRERIADAKMEITDGLKEDGCFVFNGDEPLLEQRAKDLNVEQ
YRFGLKADNDVSASDIQGTDTSTMFKTNLDEETTVTIPVLGDYNVTNALAAIAVGHKYHI
DLKKEAEALVDFDLTKNRTEWLTGKKGERILSDVYNSNPTAARAVLDSFANVNTEGRRLV
VLGDMLELGENADQMHASLAEKLNAKRFAQVYLIGPHMKALEKRLIDEDIYSKDAVHYYE
TGELKRLTDDLSTEIQANDSILLKASHGIHLENVVDKIKN
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaaatgcaacttagcgaaattgcgcgcgctcttggaacggatgaatatcctgaacta
tggaacgatattagcgtaacgagtgttcaatttgatagtcgaaaattatctccaggatca
ctttttgtgccaattatgggtgaacgtgacggacatgattttattagtcaagcagtaaca
gcaggcgccgttgcaactttatgggcggaagaccaccaagaacggcgtccagctgattta
ccaagtattctagtaaaaaatccattagaagctctgcaaaaacttgctaaatattatctg
gataagattaaccctaaggtagttgctattactggaagtaatggaaagacaactactaag
gatatgactgcagcagttctggaagcagaatataatgtggtaaaaactaaagcaaacttt
aacaacgaactgggcgtgccaattactattttgggaatgagctctaatacggaagtattg
gtagttgaaatgggaatggatcgtccaggacagttacactttttaagtgaattggttcaa
cctgatattgctgtgattacgatgattggcgaagcccatattgaattttttaagacgcgt
gagcggattgctgatgcaaaaatggaaattacagatggcctaaaagaggacggttgtttt
gtttttaacggggatgaaccgctattagaacagcgtgctaaagacctcaatgttgaacaa
taccgttttgggcttaaagcagataatgatgtcagcgccagcgatatccagggaactgac
acaagtacaatgttcaaaactaatttggatgaagaaaccaccgtaacaattccagtattg
ggtgattacaatgtaactaatgcgttagcagcaatcgccgttggacataagtaccatatt
gacctaaaaaaagaagctgaagcgctagttgactttgatttaaccaaaaatcgaacagag
tggttaactggaaaaaaaggcgaacgtattttaagtgatgtttataattctaatccgact
gctgctcgagcagtattggattcatttgctaacgtaaatactgaaggacgtcgtttggta
gttctaggagatatgttggaattaggtgagaatgctgatcaaatgcatgctagcttagct
gaaaaattaaatgccaagcgttttgcacaagtatatttaattggcccacatatgaaagct
cttgaaaaacgactgattgatgaagatatctacagtaaagatgctgttcattattatgaa
actggcgaattaaagcgacttacagatgatctttcaactgaaattcaagcaaatgatagt
attttattaaaagcaagtcacggaattcatttagaaaatgttgttgataaaattaaaaat
taa

DBGET integrated database retrieval system