KEGG   Pediococcus pentosaceus SL4: T256_07440Help
Entry
T256_07440        CDS       T02906                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ppen  Pediococcus pentosaceus SL4
Pathway
ppen00030  Pentose phosphate pathway
ppen01100  Metabolic pathways
ppen01110  Biosynthesis of secondary metabolites
ppen01120  Microbial metabolism in diverse environments
ppen01130  Biosynthesis of antibiotics
ppen01200  Carbon metabolism
ppen01230  Biosynthesis of amino acids
Module
ppen_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppen_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ppen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    T256_07440
Enzymes [BR:ppen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     T256_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind AAA_30
Motif
Other DBs
NCBI-ProteinID: AHA05567
LinkDB All DBs
Position
1437548..1438234
Genome map
AA seq 228 aa AA seqDB search
MDQNELKKLVGEEAVKFIEDGMTVGLGTGSTVKFMVDALGERVKNENLNIVGVPTSDRTA
EQARSLGINVKSVDEVDHIDLTIDGADEISSDFQGIKGGGAAHLFEKIVATNSKKVMWIV
DESKMVDHLGAFPLPLEVIPYGSKQVFKKLEKEGLHPEFRKNDAGEYVLTDSKNYVIDLH
LGEIKHPHQLADYLIKQVGIVEQGLFLDMVNTVIVGRQNGPEVLTARP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaatgaattaaaaaaactagttggcgaagaagccgttaaatttattgaagat
gggatgactgtgggtttaggtaccggttctactgttaaatttatggtggacgctcttggt
gaacgcgttaaaaatgaaaatttaaatatcgttggggtcccaacttccgatcgtacagct
gaacaagcccgttccttaggcattaatgttaaatctgttgacgaggttgatcatattgat
ttaaccattgatggagctgatgaaatcagttctgacttccaaggtatcaaaggtggcggt
gccgctcacttgtttgaaaaaattgttgccacaaactcaaaaaaagtaatgtggattgta
gatgaatctaaaatggttgatcacttaggggccttcccactccctctagaagtaattcca
tatggtagcaaacaagtcttcaagaagcttgaaaaagaaggccttcatcctgaatttagg
aaaaatgatgctggtgaatatgttttaaccgattctaaaaactacgtaattgatcttcat
cttggtgaaattaaacacccgcatcaattagcagattatctaatcaaacaagttggtatt
gtagaacaaggattgttccttgacatggttaatactgtcattgttggacgccaaaatggt
ccagaagttttgactgctcgaccataa

DBGET integrated database retrieval system