Paenibacillus peoriae: ABE82_00240 Help Entry ABE82_00240       CDS       T04053                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppeo  Paenibacillus peoriae Brite KEGG Orthology (KO) [BR:ppeo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppeo03032]     ABE82_00240    03036 Chromosome and associated proteins [BR:ppeo03036]     ABE82_00240    03400 DNA repair and recombination proteins [BR:ppeo03400]     ABE82_00240 DNA replication proteins [BR:ppeo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ABE82_00240 Chromosome and associated proteins [BR:ppeo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ABE82_00240 DNA repair and recombination proteins [BR:ppeo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ABE82_00240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ALA40075 UniProt:  A0A0K2F330 LinkDB All DBs Position 51286..51558 Genome browser AA seq 90 aa AA seqDB search MNKTDLINNISSKSGLSKRDVEAVLNGVLGEITDALASGDKVQLIGFGTFETRKRSSRTG RNPQTGNTIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctgatcaacaatatttccagcaaaagcggtttgagcaaacgtgac gttgaagctgtattgaatggcgttcttggtgaaattacagatgcactcgctagcggtgac aaagtgcaactgatcggctttggtactttcgaaacacgcaagcgttccagccgtactggc cgcaatccacaaaccggtaacacgattgaaattccagaatcgaccgttcctgcttttaaa gccggtaataagcttaaagaagccgttaactaa

DBGET integrated database retrieval system