KEGG   Paenibacillus peoriae: ABE82_02275Help
Entry
ABE82_02275       CDS       T04053                                 

Definition
(GenBank) lysis regulatory protein
Organism
ppeo  Paenibacillus peoriae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase HisKA 7TMR-DISM_7TM HATPase_c_3 HATPase_c_2 OKR_DC_1_N HATPase_c_5 Terminase_1 DUF2267
Motif
Other DBs
NCBI-ProteinID: ALA40424
UniProt: A0A0K2F339
LinkDB All DBs
Position
523272..526415
Genome map
AA seq 1047 aa AA seqDB search
MKKQGVLFFIILLLAVALPVYPLVSGVLSGNSHWKAHNGVIDLRNWHPEKEGPIQLGGEW
EFYPNQLVQPSAFHELQDKDWVNHQSSSELGMETGYSTKIVDVPGRWNQWMPEGQATGYG
TYHIRILLPEKAENLYGIYMQNIRSSSRVWIDGAEVGASGIPSVSADKGKQGNAPYVGFA
AVDGQSVDITVHVANYSYSSGGIIYPLLFGDYESITHSREVAMAEDTVLIAGFFMPTVFF
IMLYLLRKKEKALLYLGCFCIAALFYILTHGEKLLVWGIPDLPYEWILKIQSFSSTLFYY
FLIRYVHLSTQIVMNRIVLRLYNITTALMLGMGLMLPTLILSSFEAFILLFGVVSVGYVL
LILIRGLLQRTDDAALLVISIMSILMIVVTSFVYILGWGDVRGVTAYEMLIFVLAQTLLL
AKRFVHSFMEVENLSRRLLTLDGLKDEFLANTSHELRTPLHGIINIAQSMLDRYGAQFNE
PQKHNLSLIANVGRRLSYLINDILDFSNLKNGRLALNRRPVNVQAAVNSVLEVLGHTVGK
KKLQFVKEWPNSLPKVDADEDRLIQILYNLLGNAVKFTEEGEIVISAKAGNREMEISVKD
TGSGIAQEHLSHIFEPFNRGANAEDEGYSGTGLGLGIVRRLVELHGGHIRVESRLGKGST
FYFTLPLAQTGTLAHEAQKDVSSAVILQPGVTLGQNVIPHEEDALEQVQTVPYKVLAVDD
DEVNLRVLEELLYTTGCSVVAVDHAEEALHMLNGRTRFDLVITDWMMPEMSGIELCRRIR
ERYSLSELPVLLLTARDLPGDIRAGFMAGANDFLRKPVDAEELKARVRTLLNMRHSAEEA
VRSEMAFLQAQIKPHFLYNALNVIVSTVAVDPDKAAELLMELSQYLRGSFDFQNRENTVP
LSKELELVESYVALEKARFEERLQVTVEVGRNIRSLIPPLSIQPIVENAIRHGVMQRATG
GTVRVVVQEDGTDFVVSVTDDGVGIPSERLEQLLSEDHVSSSVGLRNIHRRLIHMYGEGL
RIESNSMQGTTVSFRVPETISPRNTDE
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagggtgttttattttttattatacttctgcttgcggttgcgttgccggtg
tatccgttagtgtcgggtgttttatccgggaacagtcattggaaagctcacaacggtgtt
attgatttgcgtaattggcaccctgaaaaggaaggccctatacagctgggaggggagtgg
gaattttaccccaatcagcttgtgcaaccttcagcctttcatgaattacaagataaggat
tgggtaaatcatcagagttcttcagagttggggatggaaacgggatattctaccaagatt
gtggatgtgcctggtagatggaatcagtggatgcctgagggacaggcgaccggatatgga
acctatcatattcgtatcctgttgcctgaaaaagcggaaaatctgtacggcatctatatg
caaaacattcggagttccagccgagtatggattgacggagcagaggtaggagctagtggt
attccctctgtttctgccgacaaaggcaagcagggcaatgctccttatgttggatttgca
gcggtagatggacaatcggtagatattaccgtacatgtggctaattatagttattcctcc
ggtgggatcatttacccattgttatttggggattacgagagtattacgcatagccgggaa
gttgcaatggcagaggacactgtactgatagcggggttttttatgcctaccgtatttttt
atcatgctgtatcttttacgtaaaaaggagaaggcattgctttacttaggatgcttttgc
atcgcggctttattttacattctgacacatggagaaaagctgctggtctggggaataccg
gacttaccttatgaatggatactgaaaatacagtcgttctcttcaacgctgttctactat
tttttgatccggtatgttcatctttcgacgcagattgttatgaatcggatcgtgctgcgc
ctctataatattacaaccgcactgatgctaggtatggggctaatgttgcctacactgata
ctctcatcctttgaagcgtttattcttctttttggcgtagttagtgtgggatatgtatta
ctgatcttgattcgtggacttcttcaacggacggatgacgctgcactgctagtcattagt
attatgagcatacttatgattgtagtgactagttttgtgtatattttgggctggggagat
gtgcgcggggtgacagcctatgaaatgctcatattcgtattggctcaaacgcttctgctg
gccaaacgttttgtacattcgtttatggaggttgagaacctgtcacgacggttgctaaca
ctggatgggttaaaggacgaattcctggcgaacacgtcacatgagttgcgcactcctcta
catggaattattaatatcgctcaatccatgctagaccgttacggggcacaattcaatgag
ccgcaaaagcacaacttgtccttgattgcgaatgtaggacgcagactttcttatttaatt
aacgatattctggatttttctaatttgaaaaatggaagattagccttaaatcgccggcct
gttaatgtacaggcagctgtaaattccgtgctggaggtattgggtcatacggtgggtaag
aaaaagctgcaattcgtcaaagaatggcccaattcgttacccaaggtggatgcggatgag
gatcggctgattcagattttgtacaatttgttgggtaatgcggtgaaatttacggaggaa
ggcgaaatcgtaatctctgccaaagcggggaaccgcgaaatggaaatcagtgtgaaggat
accgggtccggtattgcccaggagcatctttcgcatatatttgaaccttttaaccgaggg
gcaaatgctgaggatgaaggatacagtgggacagggcttggattaggaatagtccgtcgc
ctggtggagttgcatggtggtcatatccgggtagaatctagattgggcaagggttcgacc
ttttattttacactacccttggcgcagaccggaacgttggcgcatgaagctcaaaaagat
gtttcgtctgcggttatattgcagcctggcgtgacgttgggtcagaatgtgattccgcat
gaagaggatgcactggagcaagttcagactgttccctacaaagtgctggctgtagatgat
gatgaggttaatcttcgggtgctggaggagctattatataccacaggttgtagcgtggtg
gcagtggatcatgccgaggaggcacttcacatgctgaatggccgtacccgatttgaccta
gtcattacggattggatgatgccggaaatgtccggtattgagctgtgccgacggatacgg
gaacggtattccctgtccgagctaccagtgttgctgctgacggcacgcgacctgcccggc
gatatccgcgcgggttttatggcgggagctaatgattttctacgtaagcctgttgatgct
gaggaattaaaggcgcgtgtgcgcacgctgttgaacatgcgtcattcggcggaggaagcg
gtgcgttcggaaatggcctttttacaggcacaaattaagccgcattttctgtacaatgca
ttgaatgttattgtatcgaccgtagccgtagacccggataaagcagcggagctgctcatg
gagctgagtcagtatttgcggggcagttttgattttcagaacagggagaatacggtaccg
ttatccaaggagctggaattggtagaatcgtatgtggcactggaaaaagcacgatttgaa
gaacgtttgcaggtgaccgtagaggtaggaaggaacatccggtcgcttatcccgccatta
agcattcagcctatcgtggaaaatgcgatacgacatggtgtgatgcaacgggcaacaggt
ggaaccgtgcgagtggttgtgcaggaggatggaaccgattttgtagtcagcgtgaccgat
gacggcgtagggattccgtccgagcgactggaacagctgttgtcggaggatcatgtatct
tccagcgtgggactgcggaatatccatcgccgtcttatccatatgtatggagaaggattg
cggattgaaagtaattcaatgcaagggacgacggtaagcttccgtgtgccggaaacgatc
tcgccccggaataccgatgaataa

DBGET integrated database retrieval system