KEGG   Paenibacillus peoriae: ABE82_03105Help
Entry
ABE82_03105       CDS       T04053                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00052  Galactose metabolism
ppeo00511  Other glycan degradation
ppeo00600  Sphingolipid metabolism
ppeo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ABE82_03105
  Lipid metabolism
   00600 Sphingolipid metabolism
    ABE82_03105
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ABE82_03105
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ABE82_03105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 DUF4982 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ALA40575
UniProt: A0A0K2F4J6
LinkDB All DBs
Position
714545..716899
Genome map
AA seq 784 aa AA seqDB search
MGSRVIMPFKTDWKFIEGNYAGAEKMDYNDEHWRLLQVPHDWSIEKSFDPHMLYGGNQAY
LPRWSVGWYRKHFNVKPSSPKQRVYIQFDGIHSNSEVWINGHFVGERPYGYVSFQYDLTP
YIRWDEENVLAVKVDNTILSPDRWYSGAGIYRNVWLICTDYIHITEWGTYITTPEISPDE
AKVTARIQVTNHHAHAVECTIMTEMLNPQGQTKGKVENRVTLSGCETGEIEQKTRVIEPE
LWSPDNPVLYEAQTTIYCDNTEVDRYCTPFGIREVKLDTQKGLLLNGDSLKLKGVCIHHD
LGCLGAAYHDTAMKRRLQKLKEMGCNSIRFAHNPMAPELLDLCDQMGFLVVDEAFDKWKS
LFYEHLYDEWWEKDLEAMLLRDRNHPSVFMWSVGNEVENQGQPSMLKMLEQLVGFCHEKD
PTRPVTCALEPHNTPISLREGSIEAKVEHTKQLAQRVDVLGVNYQEQWYEHYRAAMPDTL
ILGTETFPYYRGKDNRVKGYLPMNPWFDVANHDYVIGQFVWSGIDYLGETSYPSKGWSSG
LIDTCGFRKPVSYLQQSLWSDQPIVHIAAFNEHMKSEFNPTWTMHWKSPAMEDHWTFPEY
GGKLIRLVTFTNCESVELIVNDESYGERKLVDYPNHLILWELPYTPGKIRAVGRNGNEKV
CEHELTTAGAPYALKLEADRTVLPADGHEISHVEVTVIDPNGIIVPNQDFDVIFKLQGDG
RILGIDNGDLTSDESFKGNERRTHRGRCLVVVQSGYVAGELLLQASADGGLLGETRLKIE
EEPK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcagagtgattatgccgttcaaaacggactggaagtttatagagggtaattac
gcaggtgctgagaaaatggactacaacgatgagcattggcgactccttcaagtccctcat
gattggagcattgaaaagtcctttgatccgcatatgctgtatggtggcaatcaagcttat
ttgccgagatggtctgtgggatggtacagaaagcattttaatgtgaagccctcctctcca
aaacagcgcgtatacatacaatttgatggcattcacagtaacagtgaggtttggatcaat
gggcattttgtgggcgagcgaccctatggatatgttagctttcaatatgatttgactcca
tatattcggtgggatgaggagaatgtgcttgccgtcaaagtggacaatacgattctttca
cctgatagatggtattcgggggccggtatttatcgtaatgtctggctgatttgtacagat
tatattcatataaccgaatgggggacttacattaccacacctgaaatttcgccagatgaa
gccaaggtgactgccagaatccaggtcactaatcatcacgctcatgccgtagagtgtacg
attatgactgaaatgctgaacccacagggacagaccaaaggaaaagtggaaaaccgagta
accctttcgggctgtgaaacgggggaaatagagcaaaaaacgcgagttatagagccagaa
ctatggtcaccagacaacccagtgctctacgaagcccagacgacgatctattgcgacaat
acagaggtggatcgttattgtactccttttggcataagagaagtgaagctggatacacaa
aaaggtttattgctgaatggggacagcttaaagctaaagggagtgtgcattcaccatgat
ttaggctgtctgggggcagcttaccatgatacagccatgaaaagaaggcttcaaaagctg
aaggaaatgggctgtaactcgatccgttttgctcataatccgatggcgcccgaattatta
gatttatgtgatcagatggggttcttggtggttgatgaagcttttgacaaatggaagtct
cttttctatgagcatttatatgatgagtggtgggaaaaagatctggaagcaatgttgctc
agggacaggaatcatcccagtgttttcatgtggagcgttgggaatgaagtggaaaaccaa
ggtcagccatccatgctcaaaatgttggagcaacttgtgggtttctgccatgaaaaagac
ccgactcgaccagttacatgtgcacttgagccgcataatacaccaatcagcttgcgtgag
ggttcgattgaggccaaagtggagcataccaaacagctggcacaacgagtggatgttctg
ggggtaaactatcaggagcagtggtatgagcactatagagcggctatgccggatacgctt
atccttggaacagaaacattcccatactatcggggtaaggataaccgggttaaaggttat
ttgcctatgaatccctggtttgatgtcgctaatcatgattatgtgatcggtcaatttgtt
tggagtggaattgactatttgggagaaacgagctatccctccaaagggtggtcttcgggt
ctgattgatacttgcggattccgcaaaccagtatcttatctccaacaaagtttatggtct
gatcagcctattgtgcacatagccgcatttaacgaacatatgaaatcggaatttaatccg
acatggacgatgcactggaaatctccggctatggaagatcactggacatttcctgaatac
ggtggaaaattgatacggttggttactttcactaattgtgagagtgtggaattgatcgtg
aatgatgaatcatacggtgagaggaagctagtggattaccctaatcatttaatcctatgg
gagcttccctatacaccgggcaaaatccgggctgtgggtcgtaatggaaacgagaaggtt
tgtgagcatgaactgaccactgccggggctccttatgctctaaagttggaggccgatcgg
acggttctacctgctgatgggcatgagatatctcatgtggaagtaacggtcatagaccca
aacgggatcatcgtacctaaccaggattttgatgtaatctttaaactgcagggtgatggt
cgtatccttggaatagacaatggggatctcaccagcgatgaatccttcaaggggaatgag
agacgaacacacagaggaaggtgtctcgttgttgtacaatccggttatgtggctggtgag
ttgttgcttcaagcgtcagcagatggagggttgctgggagaaaccagactgaaaatagaa
gaagaacccaaatga

DBGET integrated database retrieval system