KEGG   Paenibacillus peoriae: ABE82_03730Help
Entry
ABE82_03730       CDS       T04053                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00473  D-Alanine metabolism
ppeo00550  Peptidoglycan biosynthesis
ppeo01100  Metabolic pathways
ppeo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE82_03730 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABE82_03730 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ABE82_03730 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppeo01011]
    ABE82_03730 (ddl)
Enzymes [BR:ppeo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABE82_03730 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ppeo01011]
 Precursor biosynthesis
  Amino acid ligase
   ABE82_03730 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALA40695
UniProt: A0A0K2F4Y4
LinkDB All DBs
Position
864250..865338
Genome map
AA seq 362 aa AA seqDB search
MANQKLTVGLVYGGKSGEHEVSLQTAYAVMNAFNYEKYEIIPFYITKAGDWRRGALLSAP
LASVEQLKLERAEGGTKAALDTLFGKLYGEQTLDVLFPLLHGTFGEDGTIQGLFEMADMP
YVGAGVLASAAGMDKGVMKKLFEHAGLPQVKYCYFNSTQWAQTSHDLVRNMETELGYPCF
VKPANLGSSVGISKASNREELEKAVDLALQFDLKVIVEEYVDAREIEVSVLGNDEPIASV
PGEIVSASDYYDYAAKYTDGQSEMLIPAPLDEEVADRIREAALQAFRALEGCGISRADFF
VKRSDGHILINEVNTMPGFTPFSMYPLLWRETGVSYASLLDRMIALALERYERRSALHYE
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcaaaaattgaccgtagggctggtgtacggtggcaaatcgggtgaacatgag
gtttcgctgcaaacggcgtatgcggtaatgaacgcttttaactatgagaaatacgagatt
attcctttttatattacgaaggctggcgattggcgtagaggggcgctattaagcgctcct
ctggcttctgtagagcaattgaagctggaacgcgcagagggtggcaccaaggcggcatta
gatacattgttcggcaagctgtacggagagcagacgctggatgtgctgtttccgttgctg
cacggtacctttggcgaggacggaacgattcagggtctgttcgaaatggcggatatgcct
tatgtcggtgcgggagtgctggcttcggcagcaggtatggataaaggcgtcatgaagaag
ctgtttgagcatgcaggattgccgcaagtgaaatactgttattttaatagtacacagtgg
gcccaaaccagtcatgatctggtacgtaacatggaaaccgagctaggttatccttgcttt
gtcaaaccagccaatctgggatcaagtgtcggtatttccaaagccagcaaccgagaagag
ctggaaaaggctgtagatctggctttgcaatttgacctaaaggtgattgttgaggagtac
gtcgatgcccgtgagattgaggtcagcgtactgggcaatgatgagccgattgcctcggta
ccgggtgaaattgtatcggcgagtgattattacgattacgctgccaaatatacggatggc
caatcggaaatgcttattccggcaccgttggatgaggaagtggcagatcgtattcgtgaa
gccgcattgcaagcattccgcgctctagaaggctgcgggatttcccgtgccgatttcttc
gtcaaacgctcggacggacatatccttattaatgaagtgaatacaatgcctggttttaca
ccgttcagtatgtatccattactgtggagagaaacaggcgtatcctatgcaagtctgctg
gaccgcatgattgcccttgcactggagcgttatgagcgcaggtcggcactgcactacgag
aactcataa

DBGET integrated database retrieval system