KEGG   Paenibacillus peoriae: ABE82_06435Help
Entry
ABE82_06435       CDS       T04053                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00473  D-Alanine metabolism
ppeo01100  Metabolic pathways
ppeo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE82_06435
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ABE82_06435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppeo01011]
    ABE82_06435
Enzymes [BR:ppeo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABE82_06435
Peptidoglycan biosynthesis and degradation proteins [BR:ppeo01011]
 Precursor biosynthesis
  Racemase
   ABE82_06435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: ALA41185
UniProt: A0A0K2F6C4
LinkDB All DBs
Position
1520507..1521703
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKALPADKLILVCVKANAYGHGAVEISKELERLGAD
YLSVAFLDEALELRHAGVQLPILVLGYTSPEAVQTAWEHDISLTVFSEEVLEGIRRLDRQ
GNERKLKVHIKIDSGMGRLGLLPGEEAMAFVRQAHELEQVLLEGMYTHFARADEEDKSYT
LLQYDRFRGVAEALREQGITIPIIHTGNSAATIDTPSLSPNMVRIGISIYGLYPSDEVNR
QAIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSSEERIGTLPIGYADGYSRMLSGKI
EVLIRGRRVPVLGTICMDQCMVSLQSFAEDAEEIQTGEEVVLIGQQSGETIAADELASKL
GTIHYEVICMIADRVPRVYTRGHVPVVRVNSLLPTRWN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaagcttttcgcaaggcattgccagcggataagctgatactggtctgtgtcaaggct
aatgcctacggacacggtgccgtggaaatttcaaaggaattggaacgccttggtgcggat
tatttgagcgtcgcttttctggatgaagcgttggagcttcgtcatgcgggggttcagcta
ccgattcttgtactcggctatacctcaccggaagctgtacaaacggcttgggagcatgat
atctcattgactgtgttcagtgaagaagtgctggagggtatccgcagactggaccgccaa
ggaaacgaacgcaagctgaaggtgcacatcaaaatagacagcggcatgggaagactgggt
ttgctgcctggagaagaggctatggcttttgtccggcaggctcacgaattagagcaggtg
ctgctggaaggcatgtacacccattttgcccgcgcggatgaagaagacaaaagctataca
ctgctacaatatgatcggtttcggggcgtggcggaagcgctaagggaacaaggtatcacc
attcccattatacatacgggcaatagcgccgccaccattgataccccttctctttccccc
aatatggtgcggattggtatcagtatatacggtctgtatccgtctgatgaggttaatcgg
caagccattgagctgctgcctgtattgtcattgaagacggcggtggtttacaccaaaacg
cttcctcccggctggggagttagttatggcacccggtatgtaacctccagtgaagaacgg
atcggtacactgccaatcggctatgcggatggatactcccgcatgctgagtgggaagatc
gaagtgttgatacgcggtcgccgcgtcccggtactcggtacgatttgcatggaccagtgt
atggtatccttacaatctttcgcagaagatgcggaagaaatccaaaccggcgaagaggtt
gttctcatcggccagcagtccggcgaaactatcgcggcggatgagctggcatccaagctt
ggtacgatccactatgaggtgatctgcatgatcgcagacagggtaccgcgtgtatacaca
cgaggtcatgttcctgttgttcgagtgaactcgcttcttccaacccgctggaattaa

DBGET integrated database retrieval system