KEGG   Paenibacillus peoriae: ABE82_06930Help
Entry
ABE82_06930       CDS       T04053                                 

Definition
(GenBank) DNA mismatch repair protein MutT
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ppeo  Paenibacillus peoriae
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppeo03400]
    ABE82_06930
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     ABE82_06930
DNA repair and recombination proteins [BR:ppeo03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    ABE82_06930
 Prokaryotic Type
    ABE82_06930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ALA41270
UniProt: A0A0K2F6J8
LinkDB All DBs
Position
1622100..1622591
Genome map
AA seq 163 aa AA seqDB search
MIGLTTEVTHKIYTMCMIQDGSKVLLMNRPNRKGFPGYIAPGGKVEFPESIVNGAIREVK
EETGLTVKEIVFKGIDEYCDPSQGLRYMVFNYLATATEGELLKNPPEGELLWVDMKEALN
LPMQDWFKRRFPLFFEPGTFEVSFVWLADTDETLEATIKSYGV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatcggattgacaacagaagtgacacacaaaatatataccatgtgtatgattcaagac
ggaagcaaggtattgcttatgaatagacccaatcgaaaggggtttccgggttatattgcg
ccaggaggaaaagtagagtttccagaaagcattgtgaatggggccattcgtgaagtaaag
gaagaaacaggcttaaccgttaaggaaattgtatttaaaggaatcgacgaatattgtgac
ccaagtcaagggctgagatatatggtctttaactatttggctacagccactgaaggtgag
ctattaaaaaatccccctgagggagaattgctgtgggtggatatgaaggaggcgctaaat
ctgccgatgcaggattggtttaagcggagatttccattattttttgagccgggaacgttt
gaggttagtttcgtttggctggcggatacagatgaaaccctggaagcaacgattaagagc
tacggtgtgtag

DBGET integrated database retrieval system