KEGG   Paenibacillus peoriae: ABE82_07730Help
Entry
ABE82_07730       CDS       T04053                                 

Definition
(GenBank) K(+)/H(+) antiporter subunit KhtT
  KO
K07228  TrkA domain protein
Organism
ppeo  Paenibacillus peoriae
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ABE82_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C Castor_Poll_mid Imm40
Motif
Other DBs
NCBI-ProteinID: ALA41413
UniProt: A0A0K2F670
LinkDB All DBs
Position
complement(1763748..1764242)
Genome map
AA seq 164 aa AA seqDB search
MDIRESILPGIGIKYRIDAESGDRIVIIIHDDGRRELYHFDYEDLEQSISMTTLNDQEAR
LVASIIGGMTYKPKQLESVEMTFDDFIIEWYRVESHYASVGKSIGELDVRQNSGATVIAI
VEKKGKKYVNPGPEVIINDDATVVVVGERDQQKRFKQILMNGSG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgagagtctattttgccaggaatcgggattaagtatcgaatagatgcagag
agcggcgaccgaattgtcattattattcatgatgatggcaggcgcgagttgtatcacttt
gattacgaggatctggaacaaagtatttctatgacaaccctgaatgatcaggaagcgcga
ttggtagcctccatcatcggtggtatgacctataagcccaaacagcttgaaagtgtagaa
atgacgtttgacgattttattatcgaatggtatagagtggaatctcattatgcaagtgtc
ggcaaatccatcggtgagctggatgtaaggcaaaattcgggagccactgttattgccatt
gtggagaaaaaaggaaagaaatatgtaaatcctggtcctgaagtgattattaacgatgat
gccactgtagtcgttgttggggaacgcgatcagcaaaaacgctttaaacaaatccttatg
aacggaagcgggtga

DBGET integrated database retrieval system