KEGG   Paenibacillus peoriae: ABE82_12815Help
Entry
ABE82_12815       CDS       T04053                                 

Definition
(GenBank) fructan hydrolase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABE82_12815
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     ABE82_12815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ALA44841
UniProt: A0A0K2FG97
LinkDB All DBs
Position
2968004..2969602
Genome map
AA seq 532 aa AA seqDB search
MNRRVDTIKDMFLTGDSSSRKGSRNSYYRETYRPQFHYSPEKNWMNDPNGLVYYEGEYHL
FYQHTPHDTQPDFGRMHWGHAVSKDLIHWDELSPAIPPGEDGAIFSGSAVVDKNNTSGFF
NEEGSGLVAIYTNEGNRAQPGKPQVQSIAYSRDKGRTWTKYEGNPVLFPMETLDFRDPKV
FWHDESSMWIMVLAVRERVEFYTSPNLKEWSFASEFGSDIPHIHRGIFECPDIFQIQVDE
DPNTTKWILMLSVGDRNGVNPDDPEPPAGGSGMMYFIGNFDGKAFALDGTLESFDTIKWV
DYGSDFYAAVTWNGIPNEDGRKIWVGWMNNWRYGTTLPSEEWRGKMSIPRELQLRTYPEG
LHLIQAPISELSQLRKPILSLQDLTIKPGMNVLSDFSAAKAEIIAEFEISTAVEFGFKVR
KSSNQETIIGYNISNGDLFVDRTKSSAIDFHSDFTAIHKAPMKPEHGRVQLSIYVDWSSV
EVFGNHGETIISDMIFPDLESRGLELYAIGGELKVVSLQINDLVSIWGNENV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atcaataggagagtggataccattaaagacatgttcctaacgggcgacagtagcagcaga
aaaggatcacgaaacagttattatagggagacatacaggcctcaattccactattcacct
gagaaaaattggatgaacgatcccaacggcttggtttactatgaaggagagtaccacctg
ttctaccagcatacgccccatgatacgcagcctgactttggccgcatgcattgggggcat
gcggtaagcaaggatctaatacattgggacgaactctcaccggcaattccgcctggagag
gacggagcgatcttctcgggaagtgcggtggtggataagaacaatacaagcggatttttc
aacgaagaaggatcaggattggttgcaatttatacgaatgagggcaacagggctcagccc
ggcaagccgcaggtgcaaagcattgcttacagcagggataaaggtcgaacctggacaaaa
tatgaaggtaacccggttttattcccaatggaaacgctagactttcgtgatccgaaggtg
ttttggcatgatgaatcgtcgatgtggataatggtccttgccgtaagagaacgtgtagaa
ttttacacatctccaaacctgaaagaatggtcttttgcaagcgaattcggttctgacatt
ccgcatatccaccgagggatatttgaatgtcctgatatatttcaaatccaagtggatgag
gatcctaataccacgaagtggattctgatgctaagtgtcggggatagaaatggtgtgaat
ccagatgatccggaaccaccggcaggtggttctggcatgatgtatttcataggcaacttt
gacggtaaggcatttgctctggatggaacgttggaatctttcgatactattaaatgggta
gactacggatcagacttttacgcggccgtgacctggaatgggattccaaacgaggacggt
cgaaagatttgggtcggctggatgaacaattggcgttatggtaccacgctaccttcagag
gaatggcgtggcaagatgtcaattccccgtgagctacagcttaggacttatccggaggga
cttcacttaatccaagcacccataagtgaattaagtcagctaagaaaaccaattttgtct
ctgcaagacttgacgattaagccaggtatgaacgtgttgtctgatttctctgctgcaaag
gcagaaattattgcagaatttgaaatcagcactgccgtggaattcgggtttaaagtgcgg
aagtcttctaatcaggagacgatcattggatataatatctcgaatggggacttgttcgtc
gatcggacgaagtcgagcgccattgattttcattccgatttcacagcaatacacaaggcc
cctatgaagccagagcatggacgggtacaactgagtatttacgtggattggtcaagtgtc
gaggtcttcggaaatcatggagaaacaatcatttcagacatgattttcccggacttggaa
agcagggggctggaactctatgccattggcggagaactaaaggtcgtatcgcttcaaatc
aatgatctagtaagcatttggggaaatgagaatgtttag

DBGET integrated database retrieval system