KEGG   Paenibacillus peoriae: ABE82_20365Help
Entry
ABE82_20365       CDS       T04053                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00020  Citrate cycle (TCA cycle)
ppeo00190  Oxidative phosphorylation
ppeo00650  Butanoate metabolism
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
ppeo01120  Microbial metabolism in diverse environments
ppeo01130  Biosynthesis of antibiotics
ppeo01200  Carbon metabolism
Module
ppeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppeo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE82_20365 (sdhB)
   00650 Butanoate metabolism
    ABE82_20365 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABE82_20365 (sdhB)
Enzymes [BR:ppeo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABE82_20365 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ABE82_20365 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_13 Fer4_21 Fer2_4 Fer4_4 Fer4_6 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ALA43706
UniProt: A0A0K2FD28
LinkDB All DBs
Position
complement(4755431..4756198)
Genome map
AA seq 255 aa AA seqDB search
MSEQAVKSNKTVKFVVTRQADPKTSSYTEEFELAYRPGMNVISALMEIQRNPVDSHGKET
APVCWESNCLEEVCGACSMVINGKPRQACAALVDKLEQPITIAPMSTFPVVRDLVIDRSR
MFNALKKVKAWIPIDGTYDLGPGPRMAEKKRQWAYELSKCMTCGVCLEACPNVNEKTTFI
GPAAISQVRLFNSHPTGEMNQEERLEALMTDDGLEGCGNSQNCVRSCPKGIPLTTSIAEM
NKETTKHMFKRWLTV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcaagcagtgaagtcgaataaaacagtgaagttcgttgtgacccgtcaagct
gatcctaaaaccagttcctatacggaagaattcgaattggcttatcgtccggggatgaat
gtgattagcgcgctgatggaaattcagcgtaacccggtggacagccacggtaaagagacg
gctccggtgtgctgggagtcgaattgcctggaggaagtatgcggagcatgctccatggtg
attaacggcaagccgcgtcaggcctgtgcggcgctcgtcgataagctggagcagccgatt
acgatcgcgccgatgagcacgttcccggtagttcgggatttggtcatcgaccgcagccgg
atgtttaatgcgctcaagaaggtcaaagcgtggattccgattgacggtacctacgatctg
ggccctggtcctagaatggcagagaaaaagcgtcagtgggcgtatgagctgtccaagtgc
atgacctgcggtgtctgtctggaagcttgcccgaacgtcaacgagaagacgacgttcatc
ggacctgcggcgatatctcaggttcgcctgttcaacagccatccgacaggggaaatgaat
caggaagagcggctggaggcgttgatgacggacgacgggctggaagggtgcgggaactcg
caaaactgcgtacgctcttgcccgaaaggcattccgttgacaacttctattgccgaaatg
aacaaggaaacgaccaagcatatgttcaagcgctggctgactgtatag

DBGET integrated database retrieval system