KEGG   Paenibacillus peoriae: ABE82_22955Help
Entry
ABE82_22955       CDS       T04053                                 

Definition
(GenBank) membrane protein
Organism
ppeo  Paenibacillus peoriae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 CorA Spc7
Motif
Other DBs
NCBI-ProteinID: ALA44160
UniProt: A0A0K2FEW2
LinkDB All DBs
Position
complement(5337592..5338875)
Genome map
AA seq 427 aa AA seqDB search
MKKTGSVLAATLVAALLIQPSDGYAKSMSEINSQLNQLEKQAQSAKQQQEKAAQDKQYAQ
HYKNKTVQNLKIVLAQINSVSDQLTRVAVQIDQTEDNLRATKKDLAEAIDRIQSREKMLE
TRVRLMYTDGTVSYMDVLMSSSSFSDFLSRVDSLKTIVEQDQILLDEHKKDKALVVSKKK
QLDTEYKNAKKLYALKQDAKAELNSKEKEKQRLISNYDHDIAESDEISEEQNDMLVALAN
KRVGLVQEKNKLRAEQAAKAARARAAARAAEAKRYASSSSGAASNSSHAAASTYTGGTGT
LASPVSHYRLSSTFGMRVHPITGKLKGHTGVDMAAPQGTDIHAAEDGVVIVAEWWSGYGN
TVVIDHGDGLWTLYGHIRNGGTVVHTGQTVKRGQKIAEVGSTGNSTGPHCHFEVRENNKP
VNPMNYL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaacaggatctgtgttggccgctaccttggtagccgcattgctaatccagcct
tctgacggatatgccaaaagcatgagtgaaatcaattcgcagctgaaccaattggaaaag
caggcccaatctgccaagcaacaacaggaaaaggctgctcaagataaacagtatgctcaa
cattacaaaaataaaaccgtgcaaaacctgaaaattgtgcttgctcagattaacagcgtc
agtgatcagctgactcgtgttgcggttcagattgatcaaacggaagataatctacgtgcg
actaaaaaagatttagctgaggccattgatcgtatccagtcacgggaaaaaatgctggaa
actcgtgtgcgtttgatgtatacggatggaaccgtctcatatatggacgtgcttatgtct
tcgtccagttttagtgactttctcagccgggtagattccttgaaaacgatcgtggagcag
gatcaaatcctgttggacgagcataaaaaggacaaggcactggtcgtaagcaagaagaaa
cagctggacacggaatataaaaatgccaagaagctctatgcgctcaagcaggacgccaaa
gcagaactgaattcgaaggaaaaagagaaacaaagactgatttccaattacgatcatgat
attgctgagtcagatgaaatcagtgaagagcaaaatgacatgctggtagcactcgctaac
aagcgtgtgggtctggtgcaggagaagaacaagcttagagcagagcaggctgccaaagca
gcacgcgctagagcggctgcacgtgcggctgaagccaaacgatatgcatcttcatcctca
ggtgccgcctcgaattccagccatgcggcagccagtacgtatacaggcggaacgggcaca
ttggcttcgcctgtatcccattaccgactttcatctacttttggcatgcgggtacatccg
attaccggcaagcttaaaggccacacaggtgttgatatggcggctcctcagggaaccgat
attcatgcagccgaagatggtgttgtcattgttgccgaatggtggagtggctatggaaat
acggttgtgattgaccatggagacgggctatggaccctatacggacacattcgcaatggc
ggtacggtggttcataccgggcagactgtgaaacgtggtcaaaaaattgcagaagttggt
tcgacgggcaattccacaggacctcactgtcattttgaggtgcgcgaaaataacaaacct
gtaaatccaatgaactatttatag

DBGET integrated database retrieval system