KEGG   Paenibacillus peoriae: ABE82_23215Help
Entry
ABE82_23215       CDS       T04053                                 

Definition
(GenBank) flagellar synthesis anti-sigma-D factor
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo02020  Two-component system
ppeo02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE82_23215
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ABE82_23215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ppeo02035]
    ABE82_23215
Bacterial motility proteins [BR:ppeo02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    ABE82_23215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM HrpJ
Motif
Other DBs
NCBI-ProteinID: ALA44209
UniProt: A0A0K2FDX1
LinkDB All DBs
Position
complement(5405400..5405675)
Genome map
AA seq 91 aa AA seqDB search
MKINETNRIGAINPYQRNIETGRQEEQKKSRRKDEVSISPEAMEMLNRSSDADRVKKIQE
LKQQVASGTYRVDADKIAEKLLPYFKQSSES
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaacgagaccaaccgcatcggagctattaatccatatcagcgaaatattgaa
acaggacgtcaagaggagcaaaagaaatcccgccgcaaggacgaggtttcgatttctccg
gaagcaatggaaatgctgaaccgcagcagtgatgcagaccgtgttaagaaaattcaggag
cttaagcagcaagtagcttctggtacttatcgtgtggatgccgataaaattgcagagaag
ctgttaccttacttcaagcagtcttctgaaagctag

DBGET integrated database retrieval system