KEGG   Paenibacillus peoriae: ABE82_23235Help
Entry
ABE82_23235       CDS       T04053                                 

Definition
(GenBank) competence protein ComF
Organism
ppeo  Paenibacillus peoriae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C DEAD ResIII AAA_30
Motif
Other DBs
NCBI-ProteinID: ALA44213
UniProt: A0A0K2FE87
LinkDB All DBs
Position
complement(5408794..5410908)
Genome map
AA seq 704 aa AA seqDB search
MKIAVYAVKYKGNWTLRLSVDIRVDMTWWMNQDEGQENVVERWVLLGDELPLSWGTKLCE
TFKELADMERWGKRQWWAYILAQLKSELAPEPFNGERILSGGVENICIWDGGQGRTSRTE
SRNEGRETNGGLRSIQKRSLVTGIDGLDRECLTRQANELVNLLSGRQLLVPEAEALLAEA
ASGLERTWRSAAQLAYLQGRLSFAAGLAPAPRTRWSAARTHELRCNRCGSGIVHRTSCAS
CGRKACAYCETCLALGRSRECSLLLRGAAKPALPHTAGTAPVTELDRWGLSPAQRVAAEA
ALRFLAAPHGEVRGRFRPEGRRFRALFRRDMVACRGSGAAASQGSNLARSRQTSQKPGEG
ARYSADRQGHVITVERFLLWAVTGAGKTEMMFPLLQYVLDHGGTALVATPRRDVVLELAP
RLAIAFPNVSMVTLYGGSAERWQRGQLTLATTHQLLRYRQAFDLVVIDEIDAFPYHNDPM
LAFAARAVCKPKGKFIYLSATPPHALQKEAARGLLPHAKVPVRFHRHPLPVPFRLGTASV
QHWLQKGRLPASFIQRLRVSIQRGAQVFLFVTRISHIQGLVELLIKQLPDVPIAGTSSQD
EERTAKVRLFRATEIRVLVTTTILERGVTVPRSDVYVLDADSSLFDEASLVQMAGRAGRS
KDDPCGGVIFTSPQWTRGQKRAIRQIKRMNALARKKGYLKEVKH
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgcagtatatgcagtgaagtataaagggaattggactctccgattatctgtg
gatattcgagtagatatgacatggtggatgaatcaagatgagggacaagagaatgttgtc
gaaagatgggtgttattaggagatgagcttcccttgtcctgggggacaaagttgtgcgaa
acatttaaggaattagcagatatggagcgatggggaaaacggcagtggtgggcttatatt
ctcgcacagctaaaaagtgaactggctcctgagcctttcaacggagaacggattttatct
ggaggagtagaaaatatatgcatttgggatggtggacaagggcggacttctcgcacagaa
agtaggaatgagggacgagaaacaaacggaggtttacgttctattcaaaaaaggagcctc
gtcacgggaattgatggattggatagggagtgtttaacacgacaagcgaatgagctggtt
aatttgttgtcaggacgccagttactcgttccggaagccgaagcgctactggcagaggca
gcgtcaggtttggagcgtacttggcgatccgctgcacagcttgcatatctgcaaggccga
ctcagctttgctgctggcctcgctccagcaccacgtacgcgatggtctgccgcgcgtacg
catgaactccgctgcaaccgttgtggcagcgggatagtgcaccgcacgagctgtgcgtcg
tgcggacgtaaggcgtgcgcttactgcgagacatgtctcgcgctggggcgcagccgtgaa
tgctcgctgctgctgcgcggtgcagcgaaacccgccctgccgcacacagcaggcacagcc
ccggtgacggaactcgaccgctgggggctgagccctgcacagcgtgtcgcggccgaagcg
gcgctgcgctttttggccgcaccgcacggcgaagtgcggggacgttttcgcccggaaggc
cgtcggttccgggcattgttccggcgcgacatggttgcgtgccggggatcaggtgctgcc
gcttcgcagggcagcaaccttgcccgtagcaggcagacttcgcagaaacctggcgaaggt
gcaaggtatagcgctgatcggcaagggcacgttattacggtagaacgttttctgctctgg
gctgtaacaggcgcaggcaagacggaaatgatgtttccgctcttgcaatatgtgttggac
cacggagggacggcacttgtggcaacaccacgccgcgatgtggtacttgagttagcgcct
cgtttggccattgcttttcccaatgtgagcatggtgacgctctatggggggagcgcagaa
cgctggcaaaggggacagctgacactggcaacgacacaccagctattgcgttatcgtcaa
gcctttgacttggttgtgattgacgagattgacgcgttcccttatcacaatgatcctatg
cttgcctttgctgcacgagcagtatgtaagccgaagggaaagtttatctatttgtctgct
acaccaccccatgctttgcagaaagaggctgcacgcggtctactgccacacgccaaggtt
cccgttcgttttcatcgtcatcccctacctgtcccatttcgcctggggactgcttcagtg
caacattggctgcaaaaaggtcggcttcccgcatcctttattcaacgcctacgcgtatcc
atacaacgtggagcacaggttttcctgtttgtgacacgaatctcacatattcagggactt
gtggagctgctgattaaacaattgcctgatgtacctattgctggaacctcctcacaggat
gaagaaagaaccgctaaagtgcgcttatttcgagctactgaaatacgagttctggtcaca
acgactattttggagcgaggggtgactgttccacggagtgatgtgtatgtgttagacgca
gacagcagtctttttgatgaagcctctcttgtccaaatggctggtcgcgcgggaaggtcc
aaggatgatccatgcggaggtgttatttttacatcgccccaatggactcgaggccaaaag
agagcgattagacaaattaaacgaatgaatgcactggctcggaaaaaagggtacctgaag
gaggtgaagcactaa

DBGET integrated database retrieval system