KEGG   Paenibacillus peoriae: ABE82_25180Help
Entry
ABE82_25180       CDS       T04053                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo01100  Metabolic pathways
ppeo01120  Microbial metabolism in diverse environments
ppeo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ABE82_25180
Enzymes [BR:ppeo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ABE82_25180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: ALA44581
UniProt: A0A0K2FFJ2
LinkDB All DBs
Position
complement(5846767..5847666)
Genome map
AA seq 299 aa AA seqDB search
MKKTKQLRDLVNSQTPEFIMEAHNGLSAKIVEEAGFKGIWASGLSISAAMGVRDNNEASW
TQVLDVLEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQRHIAGVCIEDKRFPKTNSF
INGQEQTLADIEEFSGKIKAMKDTQTDTDFTVVARVEAFITGSGLKVALQRAEAYRKAGA
DAVFIHSKRSDAAEIEAFMKEWAGRLPVVIVPTKYYTTPTVRFQEMGISLVIWANHNLRA
SIQAMKQLSGRIYRDESLVHVEKEVATLEEVFRLQGVEELQAAEKKYLPSSEPDSGERV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaagcaacttagagacttggtcaattcacaaacaccagagtttatcatg
gaggctcataatggtctgtcagccaaaattgtggaggaggcaggatttaaaggaatttgg
gccagcgggttatccatctctgcagcgatgggagtaagggacaacaatgaggcctcctgg
acgcaggttttggatgttttggaattcatgagtgacgctacctccatcccgattttgttg
gacggagatacggggtacggcaacttcaacaatgcaaggcgcttggtgaagaaactggag
cagcgccatattgcgggggtatgtatcgaagataagcggttccccaaaacgaattctttc
attaacggtcaagagcagactttggctgatatcgaagagttttccgggaaaattaaagcg
atgaaagatacgcagacggacacggattttacggtggtggccagagtagaggcatttatt
accgggagtgggcttaaagtggcgctgcagcgggcggaggcatatcgaaaggcaggagcc
gatgccgtatttatacacagcaaaagatcggatgccgcagagattgaagcgttcatgaaa
gaatgggctggaagattgccagtagtgatcgtgcctaccaaatactatacgactccaacc
gtcaggtttcaggagatggggattagccttgtgatttgggcaaaccataatttgagagca
tccattcaagccatgaaacaattatctggccgaatttatcgggatgaaagccttgttcat
gtcgaaaaggaagtcgcaaccctcgaagaagtattccggcttcaaggggtcgaagagctg
caagctgcggaaaagaaatatcttccatcgtcagaaccggattcgggtgagcgcgtataa

DBGET integrated database retrieval system