KEGG   Prunus persica (peach): 18769030Help
Entry
18769030          CDS       T03092                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pper  Prunus persica (peach)
Pathway
pper00020  Citrate cycle (TCA cycle)
pper00190  Oxidative phosphorylation
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18769030
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    18769030
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     18769030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18769030
NCBI-ProteinID: XP_020424082
LinkDB All DBs
Position
G7
AA seq 633 aa AA seqDB search
MWRCVSRRLGVPSSQRSVSSDSLRSHFSRLFSTESATGRSSYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKKGDDPDVI
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQQPLEKDSGEQ
TIAWLDKIRNSNGSLPTSQIRLNMQRIMQNNAAVFRTQETLEEGSQLIDKAWESFDNVQV
KDRSLIWNSDLIETIELENLLINACVTMHSAEARKESRGAHAREDFTKRDDEKWMKHTLG
YWENEKVRLDYRPVHLNTLDDEIESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcgtcgacttggcgttccttcttcccagagatccgtctccagt
gactctcttagatctcacttctccaggctcttctccactgaatccgctacagggcgctct
tcgtacactgtggtggaccacacttatgatgcagtggttgtcggggctggtggtgcaggg
ctgagagcagccataggactttcagagcatggatttaataccgcttgcattacgaagcta
ttcccaactcgttcacatactgttgcagcccagggtggcataaatgctgcattagggaat
atgacagaggatgactggagatggcacatgtatgacacagtcaagggaagcgattggctg
ggtgatcaagatgccatccagtatatgtgtagagaggctccaaaagctgtgattgaactt
gaaaattatggattgccattttctcgaactgaagatggaagaatatatcagcgtgcattt
ggtgggcaaagccttgacttcggaaaaggtggacaagcataccgctgtgcttgtgctgct
gacagaactggtcatgctctattacatactctctatggacaagctatgaagcataataca
caattttttgtcgaatatttcgctttggatcttctaatgaacagtgatgggagctgccaa
ggagttattgcattaaatatggaggacgggactttgcatcggttccaagcagcatcaaca
attttggccacagggggttacggtagagcatatttctctgcaacctcagctcatacctgc
actggagatggtaatgccatggtcgcacgtgctggactccctcttcaggatttggagttt
gtgcagtttcaccctactggtatatatggtgctgggtgcctcatcactgaaggatcacga
ggggaaggtggtatccttaggaacagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaagaccttgcttctagggatgttgtgtcaagatctatgactatggaaatccgg
gagggtcgtggtgtaggacctttgaaggaccacatctatctccacttgaatcatttgccc
ccagatgtactcaaggagaggcttcctggtatctctgaaactgctgccatttttgctggc
gtggacgttacaaaagagcctattcccgtcttacctactgtgcattataatatgggtgga
attccgaccaattatcatggagaggtcgttaccaaaaaaggtgatgacccagatgtaata
attcctgggttaatggcagctggggaggcagcctgtgcatctgtgcatggtgccaatcgg
cttggtgcaaattcactccttgacattgttgtttttggccgagcttgtgcaaatagagtt
gcagagatccataaaccaggggagaaacaacagcctctggaaaaggattctggtgagcag
accattgcatggttggacaaaataaggaattcaaatggttcactaccaacttcgcaaatc
cggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgcacacaagaaaca
ttagaagaaggttctcagttgattgacaaggcatgggagagttttgataatgttcaagtg
aaggatcggagtttgatatggaactccgacttgatagagactatagagttggaaaacctt
ttgataaatgcctgtgtcaccatgcattccgctgaagccaggaaagagagcagaggagca
catgctcgtgaagacttcacgaaaagggatgatgagaagtggatgaaacatactctagga
tactgggaaaatgagaaggtccgactagactacagaccagttcacttgaacacattagac
gatgaaatcgagtcattcccacctaaagctcgtgtctactga

DBGET integrated database retrieval system