KEGG   Prunus persica (peach): 18772363Help
Entry
18772363          CDS       T03092                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pper  Prunus persica (peach)
Pathway
pper04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pper00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18772363
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18772363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 18772363
NCBI-ProteinID: XP_007206078
UniProt: J7H0M9
LinkDB All DBs
Position
G6
AA seq 152 aa AA seqDB search
MVKGVAVLGSSEGVKGTINFTQEGDGPTTVTGSISGLKPGLHGFHVHEFGDTTNGCLSTG
PHFNPDGKHHGAPEDEIRHAGDLGNITVGDDGTANFTIIDKQIPLAGPQSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRTACGIIGLQN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagggcgttgctgttcttggctccagtgagggtgttaaaggaaccatcaacttc
acccaagagggagatggcccaactactgtgactggaagtatttctggcctcaagcctggg
cttcatggtttccatgtccatgaatttggagacacaaccaacggttgcttgtcaactgga
ccgcatttcaatcctgatggcaagcaccatggtgcccctgaagacgagattcgccatgcc
ggtgatcttggaaatatcactgttggggacgatggaactgcaaacttcacaattattgac
aagcagattcctctcgctggaccacaatcaatcattggtagggcggttgttgtccatgca
gaccctgatgacctgggcaagggtggacatgagcttagcaaaagcactggaaatgctggt
ggcaggactgcttgtggtattattggtctccaaaactga

DBGET integrated database retrieval system