KEGG   Prunus persica (peach): 18773504Help
Entry
18773504          CDS       T03092                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pper  Prunus persica (peach)
Pathway
pper00020  Citrate cycle (TCA cycle)
pper00190  Oxidative phosphorylation
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18773504
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    18773504
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     18773504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 18773504
NCBI-ProteinID: XP_007207596
UniProt: M5WPQ4
LinkDB All DBs
Position
G6
AA seq 311 aa AA seqDB search
MSKSWIRHGFNRVARIVGRAADPKKENFPVLEGHPVAQQHAEVALETHDTVRKKDRVLKE
FKIYRWSPDHSNNKPYLHSYFLDLSNCGPMVLDALQKIKAEDDSSLSYRRSCREGICGSC
SMNIDGTNTVACLRPIDADTSKPTTITPLPHMFVIKDLVVDLTNFYQQYKLIEPWLKTKK
PPKDGREYRQSPSDRKKLDGLYECIVCACCTTSCPAYWWNPEEYPGPAALLHAYRWIADS
RDEFAEQRLQALTEGNTRLYRCRTIKNCTANCPKSLNPADAISKMKTRHLLSQPVERVED
QGYVVSGRPIG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagagctggatccgccatggcttcaacagggtagctcgaattgtaggcagagct
gctgacccaaagaaggagaactttcctgtgttagaaggccaccctgttgctcagcagcat
gcagaagtagctcttgagacccatgacacagtcagaaagaaagaccgagtgctgaaggag
ttcaagatctacagatggagccctgaccattccaacaacaagccctaccttcactcttac
tttttagacctctccaactgcggtcctatggttttggatgcattgcagaagataaaagca
gaggatgattcaagcctgagttataggaggtcgtgcagggaagggatatgtgggtcatgc
tccatgaacattgatgggacaaatactgtggcctgcctcaggcccatagatgcagacact
tccaaacccactactataactcctctgcctcacatgtttgtgatcaaagatctggttgtt
gacctcaccaatttctaccagcagtacaagttgattgagccatggctgaagacgaagaag
ccgccaaaggatggccgagagtacaggcaatcaccctcagacaggaaaaagcttgatggg
ctttatgagtgtatagtttgtgcttgttgtactacctcctgccctgcctactggtggaat
ccagaggagtaccctggaccagcggctttgctccatgcttatcgatggattgcggatagt
cgggacgagttcgcagagcaacgattgcaggcattgacagaaggcaacacgaggttatat
agatgcaggactataaagaattgcacagccaattgccccaaaagcctcaatcctgctgat
gccattagcaaaatgaagactaggcacctcttgtctcaaccagtcgaaagggttgaggac
caaggatatgttgtgtcaggcagaccaattggttga

DBGET integrated database retrieval system