KEGG   Prunus persica (peach): 18773978
Entry
18773978          CDS       T03092                                 

Definition
(RefSeq) beta-glucosidase 12 isoform X1
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pper  Prunus persica (peach)
Pathway
pper00460  Cyanoamino acid metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    18773978
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     18773978
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 18773978
NCBI-ProteinID: XP_007206638
UniProt: M5W266
LinkDB
Position
G6
AA seq 545 aa
MALQFRSLLLCVVLLLLGFALANTNAARTDPPVVCATLNRTHFDTLFPGFTFGAATAAYQ
LEGAANIDGRGPSVWDNFTHEHPEKITDGSNGDVAIDQYHRYKEDVAIMKDMGLDAYRFS
ISWSRLLPNGKLSGGINKKGIEYYNNLTNELLRNGIEPLVTLFHWDVPQALVDEYGGLLS
PRIVDDFKAYADLCYKEFGDRVKHWTTLNEPYTISNHGYTIGIHAPGRCSDWYNQNCLGG
DSGIEPYLVTHYLLLAHAAAVKLYREKYQACQNGVIGITVVSHWFEPASESQQDKDAAFQ
ALDFMYGWFMDPLTRGDYPQIMRSILGARLPNFTEEQSKSLSGSYDYIGINYYSARYASA
YPKDYSVTTPPSYLTDVHVNVTTADLNGVPIGPRAASDWLYVYPKGLYDLVLYTKEKYND
PIMYITENGMDEFNNPKLSLEQALNDANRIDYYYRHLCYLQAAMKEGANVQGYFAWSLLD
NFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKSFLKRSSISKKKIRRCGNNNGRANK
FVYQI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcattgcaattccgctctttgctcttgtgtgtggtgctgctgctccttggctttgca
ttggcaaataccaatgctgccaggacagatccacccgttgtttgtgcaactctcaacagg
actcatttcgatactctttttccagggttcacatttggcgcagctacagcagcttaccaa
ttagaaggtgctgcaaacatagacggtagaggaccaagcgtatgggataacttcacccat
gagcatccagaaaagataactgatggtagcaatggagatgttgctattgatcaatatcac
cgttataaggaagatgtggcaattatgaaggatatggggttggatgcttataggttctct
atctcatggtccagattgttaccaaatggaaaactaagtggtggaattaacaagaaggga
atcgaatactacaataatctcaccaatgaactcctacgcaatggtatagagccattagtg
acactctttcactgggatgttccccaagccttagtagacgaatatggtggtttgttaagc
cctcgtattgtcgatgactttaaagcatacgcagacctttgttataaggaatttggtgat
cgagtaaagcattggaccacacttaatgagccatataccattagtaaccatggttacaca
atcgggatccatgcaccaggacgatgctctgattggtacaaccaaaattgccttggtgga
gattcgggtattgaaccatatttggtgacacactatctactccttgctcatgcagctgct
gtaaaattgtacagagaaaaatatcaggcatgtcaaaatggtgtcataggaataactgtt
gtatcacattggtttgagcccgcttcggagtcacaacaagataaagacgctgcatttcaa
gctttggattttatgtatgggtggttcatggacccattgacaagaggtgactacccgcag
atcatgcgatccattcttggtgcacggttaccgaatttcacggaagaacaatccaagtca
ctgagtgggtcatatgactatattggaataaactactactctgctagatatgcaagcgct
tatcctaaggattattctgtaactacacctccaagctacctaacagatgttcatgttaat
gttacaacagctgatcttaatggggtccccattggtccacgggctgcttcagactggtta
tatgtttacccaaaaggactctacgatcttgtactctacacaaaggaaaagtataatgat
ccaattatgtacattactgagaatggcatggatgagttcaataatcccaaattatcactc
gagcaagcccttaatgatgctaatagaattgactattactatcgccacctctgttacctc
caagcagcaatgaaggagggtgctaatgtgcagggatactttgcatggtctttgctagac
aactttgaatggagcgaaggatatactgttcgatttggtatcaactacattgattatgac
aatggactggaaagacactcaaaactctcgacgcactggttcaaaagttttctcaagaga
tcctcaattagtaagaagaaaatccgaagatgtgggaacaataatggtagggctaacaaa
tttgtgtatcaaatttga

DBGET integrated database retrieval system