KEGG   Prunus persica (peach): 18777003Help
Entry
18777003          CDS       T03092                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:pper01009]
    18777003
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:pper03019]
    18777003
   04131 Membrane trafficking [BR:pper04131]
    18777003
   03036 Chromosome and associated proteins [BR:pper03036]
    18777003
Enzymes [BR:pper01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     18777003
Protein phosphatases and associated proteins [BR:pper01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18777003
Messenger RNA biogenesis [BR:pper03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     18777003
Membrane trafficking [BR:pper04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    18777003
Chromosome and associated proteins [BR:pper03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     18777003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18777003
NCBI-ProteinID: XP_020420171
LinkDB All DBs
Position
G5
AA seq 667 aa AA seqDB search
MEVADGVDSQSKIQQRRMRRVGLLYDERMCKHSTPDGGQHPENPDRIKVIWNKLQAAAIP
QRCVILGAKEAEDKHILSVHSKNHVNLIKNISSKQFDSRRNRVASKFNSIYFNEGSSEAA
YLAAGSAIEVTERVAKGELDSAVAIIRPPGHHAEQDEAMGFCLYNNVAIAARFLLDEKPE
LGINKILIVDWDVHHGNGTQKMFWKDPRVLFFSVHRHEFGSFYPATDDGFYTMIGEGPGA
GYNINVPWENGRCGDADYFAVWDHILVPVAKEFNPDLIIVSAGFDAAAGDPLGGCRVTPY
GYAVMLKKLMDFAHGKIVLALEGGYNLESVANSVLACVEVLLEDDPIHGSSEAYPFESTW
SVIQAVRQKLSSFWPSLADELPDKLTNKKAPPAAYILTSSSDSEEEDYEAPNAISKHLEE
VLQDVIEPLSKLKINESIQDHAASNSNTWRSELSKVDVWYATFGSNLWLKRFLCYVEGGQ
VEGMKKPYLGSGDKTPPKEIMWKTFPHRLFFGREFTHTWGPGGVAFLNPKSNIQDKTYMC
LYRITLEQFNDVLVQENVASFATSSPLFDLAALNSVTSEEPHSLQVHTELKRCWYGNVVY
LGKESNIPILTMTCTQSDMEGFKSGELAVCAPAKNYANSIVRGLVEGKQLSQEAAMAYIQ
EASTKPL
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgctgatggtgttgactctcagagcaaaattcagcagaggagaatgaggagg
gtgggattgttatacgacgagaggatgtgtaagcactctacacccgacggtggtcaacat
ccagaaaaccctgatagaattaaggtcatctggaacaagctccaagcagctgccattcct
cagaggtgtgttattttgggtgccaaagaagcagaagacaaacatatcttgtcagttcac
tccaaaaaccatgttaatctgattaagaatataagctccaaacagtttgattcacgaaga
aatcgggttgcatcaaaatttaattccatatatttcaatgaaggatcatctgaagcagct
tatcttgctgcgggctctgccatagaggtaactgaaagagttgccaaaggagaactggat
tctgccgtggctatcataaggcctccaggacatcatgctgaacaagatgaagcaatggga
ttttgtctgtacaacaatgtagccattgcagcacgtttccttttagatgaaaaaccagaa
ttgggcatcaacaaaattttaatcgttgattgggacgtgcatcatgggaatggtactcaa
aagatgttctggaaggatcctcgtgttttgttcttctctgttcataggcatgagtttgga
agcttttatccggctactgatgatggtttctatactatgattggagaaggaccaggagca
ggatacaacattaatgtcccttgggaaaatggtcggtgtggggatgcagactattttgca
gtttgggaccatattttggttcctgttgccaaggaatttaatcctgacttaattatagtc
tctgcaggatttgatgcagctgctggtgatcccctagggggttgtcgtgtcacgccatat
ggatacgcagttatgttgaagaagttgatggattttgcccatggtaaaatcgtgttggct
ttagaaggaggatacaatcttgagtctgtagcaaattcagttcttgcttgtgttgaagtt
ctgctggaggacgaccctattcatgggtcttcagaggcatatccatttgaatctacatgg
agtgtgatacaagcggttcgccagaaactaagttctttctggccatcacttgcagatgaa
ttaccagacaagctaaccaataaaaaagcgcctccagctgcttatattctgacctcaagc
tctgattctgaagaggaggactacgaagctccaaatgccatatctaaacatcttgaggag
gttcttcaggatgttatagagccactttcgaagttgaaaattaatgaaagtattcaggat
catgcggcaagcaattctaacacctggagatcagagctttcaaaggttgatgtctggtac
gctacttttggatcaaatctgtggttgaaaagatttctttgctatgttgaaggtggacag
gtggaaggtatgaaaaagccatatcttggttcgggggataaaactccgccaaaggagatt
atgtggaagactttccctcatcgcttattctttggtcgtgaatttacacatacatgggga
cctggaggggttgcattccttaatcctaaaagcaacatccaggataagacttatatgtgc
ctgtatagaattacgcttgagcagtttaatgatgtactggttcaggaaaatgttgcaagt
tttgccaccagctctcctttgtttgacttggctgctttaaactcagtcacaagtgaagag
cctcattctcttcaggttcacacagagttaaagaggtgttggtacggtaatgtcgtctac
ttgggcaaggagagtaatattccgatactgactatgacgtgtacacaatcagacatggag
ggcttcaaatctggagagcttgccgtgtgtgctccggccaaaaattatgccaactcaata
gtgagaggcctggtggaaggaaaacagctctcacaggaggcggctatggcttacatacaa
gaagcttctactaaaccattgtga

DBGET integrated database retrieval system