KEGG   Prunus persica (peach): 18778713Help
Entry
18778713          CDS       T03092                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pper  Prunus persica (peach)
Pathway
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    18778713
   00500 Starch and sucrose metabolism
    18778713
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     18778713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18778713
NCBI-ProteinID: XP_020417517
LinkDB All DBs
Position
G4
AA seq 908 aa AA seqDB search
MKMKRSRPNKPKPIYHLPLFFFFFFFFLSAVFHCGLVSSSNTKGTKEAAVAGFGYKIQSV
NYESSGNSLTANLGLIKKSSLYGPDIPNLNLHASCETKDRLRIRITDSKHQRWEIPQQII
PRQTTSQHPQQCQTHNKHLVISNDLVFTLHNTTPFGFTVTRQSSNDVIFDASPNPSNPDT
FLVFKDQYIQLSSSLPEARSSLFGLGEHTSSFKLTPNQTLTLWNADTASANADINLYGSH
PFYLDVRSASPDGKANGAGTSHGVLLLNSNGMDITYGGDRITYKAIGGIVDLYFFSGPTP
ELVVEQYTELIGRPTPMPYWSFGFHQCRWGYKNVSDLEGVVAGYEKAAIPLEVMWTDIDY
MDAYKDFTLDPINFPLDKMKKFVNTLHQNDQKYVLILDPGISVNESYGTYNRGLKADIFI
KRDGIPYLGSVWPGPVYFPDFAHPQSEKIWANEIKIFQDALPFDGLWLDMNELSNFITSP
ATPSSTLDDPPYKINNAGVLRPINNSTVPASALHFGNITEYDAHNLYGLLETKATNKALV
NVTGKRPFILSRSTFVSSGTYTAHWTGDNAAKWSDLAYTIPAILNFGLFGVPMVGADICG
FSGNTTEELCRRWIQLGAFYPFARDHSEKFTIRQELYLWDSVAATARKVLGLRYRLLPLF
YTSMYEAHKKGTPIARPLFFSFPQDIRTYEINTQFLIGRGVMVSPVLKPGVSSVDAYFPA
GNWFNLFNYSNSVSVKSGEHVTLEAPPDHINVHVCEGNILALQGKALTTEAARKTAFELL
VVSSSGQSTGEVFLDDGEEVEMGGEGGKWSLVRFYGGKKNGSVSVRSTVVNGGFALSQKW
IIDKVTIIGLEKVDGLEGYALNITKGANLKRGHSDIRASFDSNKRFITVEISKLSILIGA
DFNLELKY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaaagaagcagaccaaacaaaccaaaaccaatatatcatcttccactcttc
ttcttcttcttcttcttcttcttgtctgctgtctttcactgtggtttagtttcatcatca
aataccaagggaacaaaagaagctgcagttgctgggtttggatacaaaattcagtcagtc
aactatgaatcttctgggaactcattgactgctaatcttggcctcatcaagaaatcctcc
ctctacggacctgacatcccaaatctcaaccttcacgccagctgtgaaaccaaagatcgg
ctaagaattcgaataacagactcaaagcaccaaagatgggaaatcccacaacaaataatt
ccccgccaaacaacttcacagcatccacaacaatgtcaaacccacaacaaacacctcgtg
atctccaacgaccttgtcttcactctccacaacaccaccccattcggcttcacggtcacc
cgccaatcctccaacgacgtcattttcgacgcctccccaaacccatcaaaccccgacacc
ttcttggtcttcaaggaccaatacatccagctctcctcctccctccccgaagccaggtcc
tccctttttggcctcggcgagcacacttcctccttcaagctcacccccaaccagaccttg
acactctggaacgctgacactgccagcgccaatgctgacatcaacctctacgggtcccac
cccttctacctggacgtcaggtcagcttctccagatggcaaggccaacggcgccggaaca
tctcatggagtgttgctgctgaatagcaatggcatggacataacatacggcggtgataga
attacttataaggccattggtggaattgtggatttgtatttcttttctgggccaacaccg
gagttggtggtggagcagtatacagagctcattggtcgccctacccctatgccctattgg
tcttttggattccaccagtgtcgatggggttacaagaatgtttccgatcttgagggtgtg
gttgctggctatgaaaaagccgctatccctcttgaagttatgtggacagacattgattac
atggatgcatacaaggattttactcttgatcccatcaacttcccattggataagatgaag
aaatttgtcaacacccttcaccaaaatgatcagaaatatgtgctcatcttggaccctggt
atcagtgtgaatgagagctatggaacctacaacagagggctgaaagcagatatatttata
aaacgtgacggaattccttacctgggaagtgtttggcctggccctgtctatttccctgac
tttgcacatccacaaagtgaaaaaatttgggctaatgagataaaaatatttcaagatgct
ctgcctttcgatggtctttggcttgatatgaatgagctatccaatttcatcacgtcgcct
gccactccatcttctacacttgatgaccctccttacaagattaacaatgccggggtcctg
cgtcccatcaataacagtactgttccggcatcagcgctacactttggtaacatcacagaa
tatgatgctcataacttatatggactcttggaaaccaaagcaacaaacaaggccttagtc
aatgtgactggtaaaagaccatttatactttctagatcaacttttgtaagctctggtacg
tacacagcacactggactggagacaatgctgcaaaatggagtgatctggcatacacaatt
ccagcaattctgaattttggcctcttcggagttccgatggttggagctgatatatgtgga
ttctctggaaatactactgaagagctctgcaggcggtggattcagctaggggccttttac
ccttttgcaagagatcactcagagaagtttacaatccgtcaagagctctatctttgggac
tcggtggctgcaactgcaaggaaggtgcttggcctgcgctatcggttgctccccttgttt
tacacatcaatgtatgaggcacataaaaagggcacccccattgcaagaccccttttcttc
tcatttcctcaagatatcagaacttatgagatcaacactcagtttctgattggcagaggt
gtaatggtgtcacctgtgttgaagccaggagtaagttcagttgatgcatattttcctgca
ggaaactggtttaatctcttcaactactcaaactcagtaagcgtaaaatcgggagagcac
gttacactggaagcaccacctgatcatatcaacgtacatgtctgcgaaggaaacattttg
gccttacaaggaaaggccttgacaacagaagcagcccgaaagactgcgttcgaacttttg
gttgttagcagcagtggacagagcaccggagaagttttcttggatgatggagaggaagtg
gaaatgggaggagagggaggcaagtggagtttagtgagattttacggtggaaaaaaaaat
ggaagtgtatctgtaagatcaacggttgtcaatggaggatttgctttaagccaaaaatgg
atcattgataaagttaccatcattggattggaaaaggttgatggattggaagggtatgca
ttgaacattactaagggagcaaacttgaagcggggacactcagatatcagggccagcttt
gacagcaataagcgattcatcacagtagagatttccaaattatccattcttataggagca
gattttaacttggagctgaagtattga

DBGET integrated database retrieval system