KEGG   Prunus persica (peach): 18779393Help
Entry
18779393          CDS       T03092                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pper  Prunus persica (peach)
Pathway
pper00620  Pyruvate metabolism
pper00710  Carbon fixation in photosynthetic organisms
pper01100  Metabolic pathways
pper01200  Carbon metabolism
Module
pper_M00168  CAM (Crassulacean acid metabolism), dark
pper_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pper_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pper_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    18779393
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18779393
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     18779393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 18779393
NCBI-ProteinID: XP_007213682
UniProt: M5WNQ0
LinkDB All DBs
Position
G4
AA seq 965 aa AA seqDB search
MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC
YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK
LKKGDFADENSATTESDIEETLKRLVGDLKKSPQEVFEALKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPHNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADVLHRSTRRDAKHYIEFWKQVP
PNEPYRVILGDVRDKLYHTRERSRQLLASGHSDIPEEATLASVEQFLEPLELCYRSLCSC
GDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEERR
QEWLLSELSGKRPLFGPDLPKTEEISDVLDTLHVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSIDWYRDRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEDLIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEELLCFRTLQRFTAATLEHGMHLPVSPKPEWRALMDEMAVVATE
DYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGEAFKHVIQKDIKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGNPGIAALYDK
LLVSEDLWSFAERLRSKYEETKNLLLQIAGHKDLLEGDPHLKQRLRLRDSYITTLNVCQA
YTLKRIRDPTFHVTLRPHISKDITEANKPANELVKLNPTSEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaggaatctggagaagttggcgtccattgacgctcagcttcggcttctggtt
ccagccaaagtgagcgaggatgacaagctggttgaatatgatgctctgcttttggatcgg
ttcttggatattctccaagatttacatggagaggatctcagggaaacggtccaagcatgt
tatgagctttctgctgagtacgaaggaaagcatgatgcaaaaaaactctcagagctcgga
aatgtattaacaagtttggacccaggggattccattgttgttgcaaaatccttctcgcac
atgcttagcttggccaacttggctgaggaggtccagattgcttaccgcagacgaaacaag
ctgaagaagggtgactttgcagatgaaaattctgcaacaactgaatcagacattgaagaa
actctcaagaggcttgtgggggatctaaagaagtcgccccaagaggtttttgaggctcta
aaaaatcagactgtagatctggtcctcactgctcatcctacacaatcagttcgtagatcc
ttgcttcagaagcatggaaggattcggaattgtttaactcagttgtatgccaaagacatt
actcctgatgataagcaggagattgatgaggcacttcagagagagattcaagctgcattt
cgcacggatgagatccggagaacacctcccactccacaagatgaaatgagggctgggatg
agctacttccacgaaacaatttggaagggtgtcccaaagtttttgcgtcgtgtcgacaca
gcattgaagaatattgggattaacgaacgtgttccccataatgccccacttattcaattt
tcttcttggatgggtggcgatcgtgatggtaatccaagagtaactcctgaggtcacaagg
gatgtttgcctactagctagaatgatggctgcaaacttgtactattctcagatagaggat
cttatgtttgagttgtctatgtggcgctgcaatgatgaactccgtgtccgtgcagatgta
cttcacaggtccacgaggagagatgcaaaacactacatagaattttggaaacaagttcct
ccaaatgaaccctaccgtgtgattcttggtgatgtaagggataagctttatcatacacgt
gaacgttctcgtcagttgttagctagtgggcactctgacattcccgaggaggcaacattg
gccagtgttgagcagttcttggaacctctggaactctgttacagatcactctgctcttgt
ggtgaccgggcaattgctgatggatcacttcttgatttcttaaggcaagtgtctaccttt
ggactttcattggtgaggcttgatattagacaagaatctgaccggcatactgatgtgatc
gatgcgatcaccaagcatctagaaattggttcctatcgagagtggtctgaagaacgccgc
caggagtggcttttatctgaactaagtggaaagcgtccattgtttggccctgatcttcca
aaaactgaagaaatttctgatgttttggacactttacatgtgatatcagaacttccatct
gataactttggagcatacatcatctccatggcgactgctccatctgatgtgcttgcagtt
gagctcctgcaacgtgaatgccatgtgaagaaaccactaagggtcgttccactgtttgag
aagcttgcagatctggaggctgctcctgctgctctggctcggctcttctcaattgattgg
tatagagaccggatcaatggaaagcaagaagtcatgattgggtactcagattctggtaaa
gatgcaggacgtttctctgcagcctggcagttatacaaggcacaggaggatcttataaag
gttgctaagcaatttggtgtgaagctaactatgttccatggtcgtggtgggactgttgga
aggggaggtgggcccacccatcttgctatattgtctcaaccaccagatacgattcatggt
tcactccgtgtcactgtccaaggtgaagttattgagcagtcattcggagaggagctcttg
tgttttagaacactccagcgtttcacagctgctaccctagagcacggaatgcatttgcca
gtttcaccaaaaccagaatggcgcgcacttatggatgagatggctgttgtagctacagag
gactatcgttccattgttttccaagaaccccgatttgtcgagtatttccgtcttgctaca
ccagagctggagtatggtcggatgaacattggaagccggccctcaaagcgaaagcctagt
gggggcattgagtcacttcgtgcaatcccatggatttttgcctggacacaaacaaggttc
catcttcctgtgtggttaggcttcggagaagccttcaagcatgtcattcagaaggacatt
aagaatcttcacatgctgcaagaaatgtacaatcaatggcctttctttagggtcactatt
gatttggttgaaatggtgtttgcaaagggaaacccgggaatagctgctttatatgataaa
ctccttgtctcagaagacctatggtcatttgcagagcgattaaggtccaaatatgaagaa
accaagaaccttctgttacagattgctggacacaaggatcttcttgaaggggacccgcac
ctgaagcaaagactccgcctgcgtgattcatacatcacaacccttaatgtttgccaagca
tatacactgaaacggatccgtgatccaaccttccatgtgacgctgcggccacacatctca
aaggacattacagaagcaaacaagccagctaatgaacttgtgaagctgaacccaacaagt
gagtatgcgcctggtttggaggacaccctcatcttgacaatgaagggtattgctgctggc
ttgcagaacactggttaa

DBGET integrated database retrieval system