KEGG   Prunus persica (peach): 18779399Help
Entry
18779399          CDS       T03092                                 

Definition
(RefSeq) probable glutathione S-transferase parC isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pper  Prunus persica (peach)
Pathway
pper00480  Glutathione metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    18779399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pper02000]
    18779399
Enzymes [BR:pper01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18779399
Transporters [BR:pper02000]
 Other transporters
  Pores ion channels [TC:1]
   18779399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_5 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 18779399
NCBI-ProteinID: XP_007212046
UniProt: M5X2F2
LinkDB All DBs
Position
G4
AA seq 213 aa AA seqDB search
MGDEVVLLDFCASMFAMRARVALAEKGVKYENREEDLRNKSSLLLQMNPVHKMIPVLIHN
GKPICESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKIWGTKGEE
QEAGKKEFIEALKQLEGELGDRPYFEGESFGFLDIALIPFYSWFYAYETFGNFSTEAECP
KLIEWAKRCMQRESVSKSLADPKKVYESLVNWV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgaggttgttcttttggacttctgtgcaagcatgtttgcgatgagggcgaga
gtggcgctggctgagaagggtgtcaagtatgagaacagagaggaggacttgaggaacaag
agttcattgcttctgcagatgaacccggttcacaagatgatcccggttctcatccacaac
ggtaaaccgatctgtgagtctctgatcattgtgcagtatgttgatgaggtctggagggac
aaagctcctctgcttccctctgatccttaccagagagctcggtcaaggttctgggctgac
ttcattgataagaagctatacgttgcttcgaggaaaatatggggcacaaaaggagaggaa
caagaggcaggcaagaaggaattcattgaagcccttaagcagttggaaggagagcttgga
gacaggccttattttgagggtgagagctttgggttcttggacattgctcttatcccattc
tacagctggttctatgcatatgagacttttggaaacttcagcacagaggcagagtgcccc
aagctgattgaatgggccaagaggtgcatgcagcgggagagcgtgtcgaaatctcttgca
gaccctaaaaaggtgtatgagtctcttgttaattgggtatag

DBGET integrated database retrieval system