KEGG   Prunus persica (peach): 18781060Help
Entry
18781060          CDS       T03092                                 

Definition
(RefSeq) cation-chloride cotransporter 1
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
pper  Prunus persica (peach)
Brite
KEGG Orthology (KO) [BR:pper00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pper02000]
    18781060
Transporters [BR:pper02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   18781060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12 Na_Ala_symp
Motif
Other DBs
NCBI-GeneID: 18781060
NCBI-ProteinID: XP_007213604
UniProt: M5WZQ3
LinkDB All DBs
Position
G4
AA seq 984 aa AA seqDB search
MDNADVEAGGEDEFHGKSGRKYRPVVDDDRAVLEMSSMDPSSSSSSSSALPVHQASLKRI
KVGTQENVGSDAKEGHPPTHVQANGPQRESKLELFGFDSLVNILGLKSMTDEQSAAPSSP
RDGENISITQGRPKPTGVKLGTLMGVFVPCLQNILGIIYYIRFSWIVGMAGIAESLFLVS
FCGLCTFLTAISLSAIATNGAMKGGGPYYLIGRALGPEVGVSIGLCFFLGNAVAGSLYVL
GAVETFLKAVPAAGIFRETTRVNGTSVAIQSPSSHDLQIYGIVVTIILCFIVFGGVKMIN
RVAPAFLIPVLLSLFCIYIGIALARKNYPVDGVTGLSLDSFKENWNSDYQKTNNAGIPDP
DGKVSWNFNAMVGLFFPAVTGIMAGSNRSASLRDTQRSIPIGTLAATLSTTAMYLVSVLL
FGALASRQKLLTDRLLTATIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIANDDIL
PVLNYFKVSDGSEPNIATLFTALLCIGCVVIGNLDLITPTITMFFLLCYAGVNLSCFLLD
LLDAPSWRPRWKFHHWSLSLLGALLCIVIMFLISWSFTVVSLALASLIYYYVSIKGKAGD
WGDGFKSAYFQLALRSLRSLGANQVHPKNWYPIPLIFCRPWGKLPENVPCHPKLADFANC
MKKKGRGMSIFFSILDGDYRECAEDAKAACKQLATYLDYKNCEGVAEIVVAPSMSEGFRG
IVQTMGLGNLKPNIVVMRYPEIWRRENLTEIPATFVEIINDCIVANKAVVIVKGLDEWPN
EYQRQYGTIDLYWIVRDGGLMLLLSQLLLTKESFESCKIQVFCIAEEDTDAEGLKADVKK
FLYDLRMHAEVIVVTMKSWDVQADSGSPQDESVEAFSGAQQRIANYMADMKAASEKQGTS
LMADGKPVVVDEQQVEKFLYTTLKLNSTILRYSRMAAVVLVSLPPPPANHPAYFYMEYMD
LLVENVPRLLIVRGYRKDVVTLFT
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgccgacgttgaagctggtggagaagacgagttccatggcaagagcggtcgc
aagtatcgcccggttgtcgacgacgatcgcgccgtgctcgagatgtcatccatggatcct
tcctcttcttcttcttcttcgtctgctcttcctgttcaccaagcttccctcaagagaata
aaagtgggcacccaggaaaacgtgggttctgatgcaaaagaagggcacccacctactcat
gtgcaagccaatgggccccagagagaatccaaattggaattgtttggttttgattctctc
gtcaacattctcggtcttaagagtatgacagatgagcaaagtgcagcaccatctagtcct
agagatggtgaaaatatttctatcacccaggggcgaccgaagcctactggtgtcaaattg
ggaacactgatgggtgtattcgtcccgtgcttgcaaaatatactaggaattatctactat
attcgattttcttggattgttggtatggctggtatagctgagtcactattcttggtttca
ttctgtggcttgtgtactttcctgactgcaatatcattgagtgcaattgcaaccaatggt
gctatgaagggtggtggaccgtactatctaattggtcgtgcccttggtccagaagttgga
gttagcattggattatgtttctttctaggaaatgctgttgctggatctctttatgtcttg
ggagctgttgaaacattcttgaaagctgtgccagctgctgggatttttagagagaccaca
agagttaatggaacatcagtcgcaatacaaagtccgagttcacatgacctgcaaatctat
gggatagttgtgactattattttatgctttattgtgtttggtggtgtgaaaatgatcaat
cgggttgcacctgctttcctcatacccgttttactttcgctgttctgcatatatatcggg
attgctttggcgaggaagaattaccctgtagatggagtcacgggcttgagtttggactcc
ttcaaagaaaactggaattcggattatcagaagaccaataacgctggaattcctgatcct
gatggaaaagtgtcctggaatttcaatgcaatggtcggcctctttttccctgctgtgacg
ggaattatggcaggttcaaatcggtcagcgtcactgagagatactcagcgttcaattcct
attggaacactggctgcgactctttcaactactgcaatgtatctggtctctgtgttatta
tttggagcccttgctagcagacagaagcttttgactgataggctacttactgctacaata
gcttggcctttcccagtattcatttacattggaataattctatcaaccttgggcgctgct
cttcaaagcctgactggtgctccacgtctgcttgcagcaatagccaatgatgatatttta
cctgttcttaactacttcaaggtttcagatgggagtgagcctaacattgctaccttattt
accgcgctcctctgtatcgggtgtgtcgtaattgggaacctggatcttatcacgccaact
ataactatgtttttccttctgtgttatgcgggcgtgaacttatcttgcttccttctggat
cttctagatgctcccagctggcgtccgcggtggaaatttcaccactggagcctctctctt
cttggagccttactttgtatagtgataatgttcttgatctcctggtcattcactgtcgtg
tctctagccctggcaagccttatatattattatgtgagcatcaaaggaaaggctggggac
tggggtgatggtttcaagagtgcatatttccaactagctcttcgcagtcttcgatcgcta
ggagcaaaccaagtgcacccaaagaattggtatcccatccccctgatattctgccggcct
tgggggaagctgccagaaaatgtaccttgccatcccaaacttgctgactttgccaactgt
atgaagaagaagggcaggggaatgtccatctttttttctattctagatggtgactaccgt
gaatgtgctgaagatgccaaggctgcatgcaagcagcttgctacctaccttgactacaag
aattgtgaaggtgtagctgagattgttgtggcccccagtatgtctgaaggtttccgtggc
attgttcagacaatgggtcttggaaatctgaagccaaacattgtggtgatgcggtatccc
gaaatatggcgtcgtgaaaacttgacggaaattccagccacctttgttgaaataattaat
gattgcattgttgcaaacaaggcagttgttattgtcaagggtcttgacgaatggcccaat
gagtatcagaggcagtatggtaccatcgatttgtattggatagtgagagatggtggtctc
atgcttcttctctctcaactcctcctcactaaggaaagctttgagagttgtaaaatccag
gttttctgcattgcggaagaggatactgatgcagaggggctcaaggctgatgtaaagaag
tttctgtatgatcttcggatgcatgccgaagtgattgttgtaacaatgaaatcgtgggat
gtgcaagctgacagtgggtctcctcaagatgaatctgtggaagcattttctggtgctcag
cagcgtatagctaattacatggctgatatgaaggcagcatcagaaaaacagggaacctcg
ctgatggctgacgggaagccggttgtcgtggatgaacagcaggtggagaagtttctttac
actactctgaagctgaattcaacaatactcagatactcgagaatggctgcagttgttctt
gtgagcttacctccacctccggccaaccacccggcatacttctacatggagtacatggat
ttgttggtggaaaatgtgccacgactactgattgtgagaggataccgtaaagatgttgta
actctattcacatag

DBGET integrated database retrieval system