KEGG   Prunus persica (peach): 18781757Help
Entry
18781757          CDS       T03092                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pper  Prunus persica (peach)
Pathway
pper03030  DNA replication
pper03410  Base excision repair
pper03420  Nucleotide excision repair
pper03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pper00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18781757
   03410 Base excision repair
    18781757
   03420 Nucleotide excision repair
    18781757
   03430 Mismatch repair
    18781757
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pper03032]
    18781757
   03400 DNA repair and recombination proteins [BR:pper03400]
    18781757
Enzymes [BR:pper01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18781757
    6.5.1.6  DNA ligase (ATP or NAD+)
     18781757
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18781757
DNA replication proteins [BR:pper03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18781757
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18781757
DNA repair and recombination proteins [BR:pper03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18781757
   NER (nucleotide excision repair)
    Other NER factors
     18781757
   MMR (mismatch excision repair)
    Other MMR factors
     18781757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL UBA_4 Lactamase_B_2 CDT1_C Lactamase_B
Motif
Other DBs
NCBI-GeneID: 18781757
NCBI-ProteinID: XP_020414775
LinkDB All DBs
Position
G3
AA seq 1378 aa AA seqDB search
MASSSSSTTKTQTLDSTRLFLTALATFSHQPNPPQLSFPPIPSTFPHSKLIPKTRFSVDA
FRHAGDHSVSYFLSHFHSDHYGGLSPNWAKGVVFCSQTTARLLNEVLKISSLFVVALPLD
EAVVIDGCEVVLIDANHCPGAVQFLFKVPGFNGKFERYVHTGDFRFSGSMKSDPFLCEFV
GSDAIFLDTTYCNPKFVFPLQEESVNYIASLIETVGGEYKSSMKNVLFLVATYVIGKEKI
LLEIARRCNRKVHVDARKMAVLRVLGYGESGVFTEDECESDVHVVGWNVLGETWPYFRPN
FVKMKEIMVEKGYSKVVGFVPTGWTYEVKRNKFSVRSKDSFEIHLVPYSEHSNYDELREY
VRFLKPKHVIPTVGLDVEKLDSKHANKMQKHFAGLVDEMANKKEFLRGFLLGSTEVGDNV
ENESNNGPIEGLDQEKETMPSDKDTVHMELSSSLQEPDPQNPMVLDDEEVEKIIQELRDC
LPTWVTQEQMLDLIGSSGGDIVESVSKFYERETEFHDQVISSTNAVSESQTSSLCDSGSL
PKGGSVTSSPYGSTDVPSSQEYISLKPRNVIKSGISPGKRARNTNNKVNKRVKLNSKLDS
RGPKQLAITKYFSKVLPDVQETLEIGSMDEQNLKDESLPHDDTKSYRDEIDQFLQIIDGT
ESLESYAATILRKTNGDINEALNIYYCNREVRSGKNEAGLVVDSGKMKPTADSSVEVSLQ
ENVKTTVLSLPPEKYNPTEDACWSRGQRAPYLHLARTFDLLEDEKGKIKATSMLCNMFRS
LLALSPEDVLPSVYLCTNKIAADHENVELNIGGSLVTSALEDACGTSRSKIREMYNELGD
LGDVAQACRQTQKLLAPPSPLLIKDVFFALQKISVQTGSGSTGRKKSLILNLMRSCREKE
MKFLVRTLVRNLRIGAMMKTVLPALAQAVVMNSSHNFNHEGALQSLKDRLQLHSAAVVEA
YNVLPNLDLVVPSLMDKGIGFSSSTLSMVPGIPIKPMLAKITNGVQQALKLLGNKAFTCE
YKYDGQRAQIHKLVDGSVRVFSRNGDESTSRFPDLIKIINESCKPDAVTFILDAEVVAID
RKNGLKLMSFQELSSRGRGSRDTSITLDSIKVDICVFVFDIMFANGQQLLGFPLRKRRKY
LKDMFYDEKLGYFEYAKEMTVEADDACLTSEATLTKINCFLENAFLSSCEGIMVKSLDVD
AGYSPSKRTDTWLKVKRDYMEGSNDSLDLVPIGAWHGNGRKAGWHSPFLMACYNPDTEDF
QSVCRVMSGFSDSFYTEMKSFFSGDKILSRKPPYYKTAEAPDMWFPPELVWEIRGADFTV
SPVHQAAVGLVHPSRGISIRFPRYVRTLADRKPDECSTSEDIAAMFCSQTRKMDIAED
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctcctcctcctccacaaccaaaacccaaaccctagattccacccgcctcttc
ctcactgccctcgccaccttttcccaccaacccaaccccccccagctctccttccctcca
attccctccacattccctcactccaaactcatccccaaaacccgtttctccgtcgatgca
tttcgccacgcaggcgatcactccgtctcctacttcctctcccatttccactccgatcac
tatggcggcctctcccccaattgggctaaaggcgttgtcttttgttcacagaccaccgct
cgtcttctcaacgaggtgctcaaaatctcttcgcttttcgtggtcgctttgccgctcgac
gaagcagtggtaatagatggctgtgaggttgtgcttattgacgcgaatcactgtccgggt
gcggttcaattcttgtttaaagttccgggttttaatggaaagtttgagaggtacgttcat
actggcgattttcggttttctggttcgatgaagtcagacccttttttgtgtgaatttgtg
ggttcggatgcgattttcttggacaccacctattgtaatccgaagtttgtgtttccactg
caagaagaatctgttaattatattgctagtttgatagaaacagtagggggtgaatataaa
agttctatgaaaaatgttttgtttcttgtagctacttatgttattgggaaagagaagatt
ttgctggaaattgctcgtaggtgtaatcgtaaagtacatgtggatgctcgaaaaatggcg
gtgttgcgtgttttgggctacggagagagtggggtatttacggaggatgagtgcgaaagt
gatgtacatgttgttgggtggaatgtcttgggcgagacttggccatattttaggcctaat
tttgtgaaaatgaaggagattatggttgagaaagggtactctaaggttgtgggatttgtt
cctactggttggacttatgaagtgaagcgtaacaagttttcagtgaggtcaaaggattcg
tttgagatccatcttgtaccgtatagtgaacattctaactatgatgaacttagggaatat
gtgaggtttttgaaaccaaagcatgttattcctacggtgggcttggatgttgaaaagctt
gatagtaagcatgccaataaaatgcaaaagcattttgctgggttagtcgatgaaatggca
aacaagaaagagttcttgaggggctttcttcttggatccacagaagttggtgacaatgtt
gaaaatgagtccaacaatggtcctattgaagggctggatcaagagaaagagacaatgcca
tctgataaggatactgtgcacatggaattatcatcttctctacaagaacctgatccacaa
aatccaatggtattagatgatgaagaagtagagaaaatcattcaagaacttcgtgattgt
ttgcccacatgggtcactcaagagcagatgttagatctgattggaagctcaggaggggac
attgttgaatcagtttccaagttttacgaacgcgaaacagaatttcatgatcaagttatt
tcttctacaaatgctgtttctgaatcccagaccagctcactttgtgactctggatcactc
ccaaaaggaggttctgttacgagcagtccatatggaagtactgacgttccttcaagtcaa
gaatatatctcactgaagccaaggaatgtaattaaaagtggaatttctcctggaaaaagg
gcgagaaacactaataataaggtaaacaaaagggttaaattaaattccaaattggattca
cgtgggccaaagcaactggcaataacaaagtattttagtaaagttttgcctgatgttcaa
gaaactctggagattggatcaatggatgaacaaaaccttaaagatgaaagtttgccgcat
gatgacaccaaatcatacagagatgagatagatcagtttcttcagataatagatggtact
gaatcattagaaagctatgctgccaccattctgaggaagacaaatggagatatcaatgag
gcgctgaatatatattactgtaatcgcgaggttaggtctggtaaaaatgaagcagggttg
gtggttgattcagggaaaatgaagccaacagctgattcatctgtggaggtatcattacaa
gagaatgtaaaaacaactgttctgtcattaccaccagaaaaatacaatcctacagaagat
gcgtgctggagccgtggacagcgcgctccatatttacatcttgcacgaacttttgactta
cttgaggatgaaaaaggcaagataaaagctacttctatgctctgcaatatgttcagaagt
ttgcttgccttgtctcctgaggatgtgctgccttcagtgtatttgtgcacaaataagatt
gctgcagaccatgaaaatgtggagctaaacattggtggaagtttggtcacatcagcactg
gaagatgcatgtggcacaagccgatccaaaataagggagatgtacaatgagttgggtgat
ctaggtgatgtggctcaagcatgccggcagacacagaagctacttgcccctccttcaccg
cttctaataaaagacgtatttttcgcactccaaaagataagtgtacaaacaggtagtggg
agcactggtcgaaagaaaagcctcattctgaatctcatgcgctcttgtagagagaaagaa
atgaagtttcttgttagaactttggttaggaatttgcggattggagcaatgatgaaaact
gttctacctgctctggctcaagctgttgtcatgaattcctctcataacttcaatcatgaa
ggagcattacaaagtttgaaagataggcttcagctccattcagcagctgtggtcgaagca
tacaatgtactgcccaatttggatttggtcgttccttctctcatggacaaaggcattgga
ttctcttcatcaactttgtcaatggttccaggaatacctattaagccaatgcttgcaaaa
atcacaaatggtgttcagcaagcactaaagctcttaggaaataaagcttttacctgtgaa
tacaaatatgatggtcagcgtgcccaaattcacaaattagttgatgggtctgtgcgtgtt
ttctcacgaaatggggacgaatcaacgtcaagatttccagatctgatcaagataattaat
gaatcttgtaagcctgatgcagtcactttcatactagatgcggaggtggttgcaattgat
aggaagaatggtctgaagctaatgtctttccaagagttgtcttcacgcgggagagggagc
agagatacatcaattacattggatagcataaaggttgacatttgtgtatttgtctttgat
atcatgttcgccaatggacagcagttgttgggctttcctctacggaaaagacgaaaatat
ttgaaagatatgttttatgatgagaagttgggttattttgagtatgccaaggaaatgaca
gtcgaagcagatgatgcttgtttaaccagtgaagcgacgttaacgaagatcaactgtttt
ctcgaaaatgcattcctctcctcatgtgaagggattatggttaaatctttagatgttgac
gctggatattctccatcaaagcgtacagatacatggttaaaggtcaagcgagactacatg
gaaggatcaaatgactctcttgatttagtcccaattggagcttggcatggaaatgggaga
aaggcaggctggcacagtccatttcttatggcatgttataaccctgatactgaggatttc
caaagcgtctgccgcgtcatgtctgggttctcagattcattttacactgagatgaaaagt
ttcttttctggagacaagatcttgtccagaaaaccaccttattataaaaccgctgaggcg
cctgatatgtggtttcctccggaacttgtatgggaaataagaggtgcagactttactgtg
tctcctgttcaccaggctgccgtaggtttagttcatccatcacgtggaatttcaatcaga
ttcccaagatacgttcgcactctggctgatagaaaaccagatgaatgtagcacatctgaa
gatatagctgcgatgttttgttcccagacaaggaagatggacattgctgaagattga

DBGET integrated database retrieval system