KEGG   Prunus persica (peach): 18781777Help
Entry
18781777          CDS       T03092                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pper  Prunus persica (peach)
Pathway
pper00620  Pyruvate metabolism
pper00710  Carbon fixation in photosynthetic organisms
pper01100  Metabolic pathways
pper01200  Carbon metabolism
Module
pper_M00168  CAM (Crassulacean acid metabolism), dark
pper_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pper_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pper_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    18781777
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18781777
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     18781777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 18781777
NCBI-ProteinID: XP_007214986
UniProt: M5XAV2
LinkDB All DBs
Position
G3
AA seq 962 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC
YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELLSRAHELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYSTRERARQLLANGISEIPEETTFTNVEQFLEPLELCYRSLCSC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLNAITRHLEIGSYREWSEERR
QEWLLSELSGKRPLFGSDVPKTEEIADVLDTFHVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECGVKKPLRVVPLFEKLADLEAAPAAVGRLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKQYAVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEIXGIHRS
IVFQEPRFVEYFRRATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPV
WLGFGAAFKHAIDKDAKNLHMLREMYNQWPFFRVSIDLIEMVFAKGDPGIASLYDKLLVS
EDLWSFGERLRANYEETKSLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQAYTLK
QIRDPNYHVKVRPHLSKEYMETTSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGMQN
TG
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggaacttggagaagatggcttcaattgacgcacagctgaggctgctggca
ccagggaaggtgtctgaggatgacaaactgattgagtatgatgctttgttattggatcgc
ttccttgacattcttcaggatttacatggagagagtctcagagaaacggtgcaagattgt
tatgaactttccgcagaatatgaaagaaagcaggaccctaaaaaattggaggaacttggg
aaggttctaacgagtttggatcctggggactcgattgtcattgctaagtccttttctcac
atgcttaacttggccaatttggccgaggaagttcagattgcttatcgaaggaggatcaag
ttgaagaagggagacttcgctgatgaggcttcagctactacagagtcagacattgaagag
actctcaagaggcttgtgggagacctgaagaagtccccggaagaagtttttgatgccttg
aagaaccagactgtagatttggtcctaacagcacatcctactcagtctgttcgaagatcc
ttgcttcaaaagcacgcaagggtaagaaattgtttgacacagttgtatgctaaggacatt
acacctgatgataaacaggaactcgatgaggctctacaaagagagattcaagctgcattt
cgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagagcgggaatg
agctactttcatgagacaatttggaaaggtgtaccgaaattcttacgtcgtgttgacact
gctttgaagaacatagggataaatgaacgtgttccttacaatgcccctctcattcaattt
tcttcttggatgggtggggaccgtgatggaaaccccagggtcactcctgaggttacacgg
gatgtatgtttattggctagaatgatggctgctaacttgtacttctcccagatagaggat
cttatgtttgagttatctatgtggcgctgcaatgatgagcttctttctcgtgctcatgaa
cttcataggtcttcaaagaaggatgcgaaacactatatagagttttggaagcaaattcct
ccaaatgagccttatcgtgttattcttggtgatgtaagagacaagctatacagtacacgt
gaacgtgctcgccaattgttagccaatggaatctctgaaattcctgaggaaacaaccttt
acaaatgttgaacagttcctggagcctctcgaactgtgttaccggtcactctgctcttgt
ggcgatcggccaattgctgatggaagccttcttgatttcttacggcaagtttccactttt
gggctctctcttgtgagactagacatacggcaagaatcagacaggcacactgatgtcctc
aatgctataacaaggcacctggagattgggtcttatcgagaatggtccgaggaacgtaga
caagaatggctcttgtctgagcttagtggcaagcgccccctttttggttctgatgttccc
aagactgaagaaattgctgatgtgctggacacattccatgtcatttcagaacttccctcg
gacaattttggtgcttatattatctcaatggcgacagcaccatctgatgtgcttgctgtt
gagcttttgcaacgtgaatgtggtgtgaagaaaccactaagggttgtcccattgtttgag
aagcttgctgatcttgaggctgctcctgctgccgtgggccgtctcttttcaatagattgg
tacaaaaacaggatcaatgggaagcaagaagtcatgataggatactcagattcaggaaag
gatgctggccgtctatctgcagcatggcagttatacaaggctcaagaagagctcataaag
gttgcgaaacaatatgcggttaagcttacaatgtttcatggtcgaggtggaacagttgga
agaggaggggggcccactcatcttgctatattgtctcagccaccagacacaattcatggt
tcacttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggagcacttg
tgctttagaacactccagcgtttcacagcagctacacttgagcacggaatgcatcctcct
gtctcaccaaagcctgaatggcgtgcactaatggatgagatannaggaatacaccgttca
atagttttccaggaacctcgttttgttgaatactttcgccgtgcaacaccagagatggag
tatggccggatgaacattgggagtcgtccttcaaaacgaaagccaagtggaggcattgaa
tcactacgtgcaatcccatggatatttgcttggacccaaacaagatttcatttaccagtg
tggcttgggtttggggcagcatttaagcatgctattgacaaggatgcgaaaaatctccat
atgcttcgagagatgtataatcagtggcctttcttcagagtgtcgattgatttaattgag
atggtgtttgccaagggcgacccgggtattgcctctctgtatgacaagctgcttgtgtca
gaagacctatggtcatttggagagagattgagggccaactatgaagaaactaagagcctc
gtcctccaggttgctggacatagggctcttctggaaggagatccttatttaaggcagaga
ctcctcctccgtgactcttacatcaccacacttaatgtgtgccaagcctatacactgaag
cagattcgtgatccgaactaccatgttaaagtaaggccacacttgtcaaaggagtacatg
gaaacaacaagcaagccagcggcagagctcgtaaagcttaatccaacaagcgagtatgct
cctggactagaagacacacttattttgaccatgaagggtattgctgctggaatgcagaat
accggctga

DBGET integrated database retrieval system